BLASTX nr result
ID: Ophiopogon26_contig00040251
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040251 (1777 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN06112.1| cytochrome c oxidase subunit 3 (mitochondrion) [G... 51 2e-10 ref|YP_003875546.1| cytochrome c oxidase subunit 3 (mitochondrio... 51 2e-10 gb|AHJ10970.1| cytochrome c oxidase subunit 3 (mitochondrion) [R... 51 5e-10 ref|YP_008474725.1| cytochrome c oxidase subunit 3 (mitochondrio... 49 7e-10 gb|AMP88012.1| cytochrome c oxidase subunit 3 (mitochondrion) [F... 48 3e-09 gb|AFN42482.1| cytochrome c oxidase subunit 3 (mitochondrion) [R... 51 4e-09 ref|YP_002587032.1| cytochrome c oxidase subunit 3 (mitochondrio... 51 4e-09 dbj|GBC54036.1| Cytochrome c oxidase subunit III [Rhizophagus ir... 51 2e-06 >gb|AFN06112.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus sp. DAOM 229456] Length = 269 Score = 51.2 bits (121), Expect(2) = 2e-10 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 1104 GCSWPPTSIQPIDPWELLLVNTIL 1033 GCSWPP IQPIDPWEL LVNTIL Sbjct: 115 GCSWPPAGIQPIDPWELPLVNTIL 138 Score = 45.1 bits (105), Expect(2) = 2e-10 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 1286 LLWVYVIREGTFLGHHTVRVXXXXXXXXXLFIVSEI 1179 L W VIREGTFLGHHTVRV LFIVSE+ Sbjct: 58 LWWADVIREGTFLGHHTVRVQQGLILGIILFIVSEV 93 >ref|YP_003875546.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] ref|YP_009228198.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus fasciculatus] gb|ADM94802.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AGA14225.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AGA14257.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AGJ98050.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AGJ98074.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus sp. DAOM 240422] gb|AJK91329.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus fasciculatus] gb|AJK91360.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus aggregatum] gb|AML60495.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AML60521.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AML60546.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AML60590.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] Length = 269 Score = 51.2 bits (121), Expect(2) = 2e-10 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 1104 GCSWPPTSIQPIDPWELLLVNTIL 1033 GCSWPP IQPIDPWEL LVNTIL Sbjct: 115 GCSWPPAGIQPIDPWELPLVNTIL 138 Score = 45.1 bits (105), Expect(2) = 2e-10 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 1286 LLWVYVIREGTFLGHHTVRVXXXXXXXXXLFIVSEI 1179 L W VIREGTFLGHHTVRV LFIVSE+ Sbjct: 58 LWWADVIREGTFLGHHTVRVQQGLILGIILFIVSEV 93 >gb|AHJ10970.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus sp. DAOM 213198] Length = 269 Score = 51.2 bits (121), Expect(2) = 5e-10 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 1104 GCSWPPTSIQPIDPWELLLVNTIL 1033 GCSWPP IQPIDPWEL LVNTIL Sbjct: 115 GCSWPPAGIQPIDPWELPLVNTIL 138 Score = 43.5 bits (101), Expect(2) = 5e-10 Identities = 22/36 (61%), Positives = 23/36 (63%) Frame = -3 Query: 1286 LLWVYVIREGTFLGHHTVRVXXXXXXXXXLFIVSEI 1179 L W VIREGTFLGHHT RV LFIVSE+ Sbjct: 58 LWWADVIREGTFLGHHTARVQQGLVLGIILFIVSEV 93 >ref|YP_008474725.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus cerebriforme] gb|AGJ98107.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus cerebriforme] Length = 269 Score = 49.3 bits (116), Expect(2) = 7e-10 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 Query: 1104 GCSWPPTSIQPIDPWELLLVNTIL 1033 GCSWPP IQPI+PWEL LVNT+L Sbjct: 115 GCSWPPAGIQPIEPWELPLVNTVL 138 Score = 45.1 bits (105), Expect(2) = 7e-10 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -3 Query: 1286 LLWVYVIREGTFLGHHTVRVXXXXXXXXXLFIVSEI 1179 L W VIREGTFLGHHTVRV LFIVSE+ Sbjct: 58 LWWADVIREGTFLGHHTVRVQRGLMIGIILFIVSEV 93 >gb|AMP88012.1| cytochrome c oxidase subunit 3 (mitochondrion) [Funneliformis mosseae] Length = 275 Score = 47.8 bits (112), Expect(3) = 3e-09 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -2 Query: 1104 GCSWPPTSIQPIDPWELLLVNTIL 1033 GC+WPP IQPIDPWE LVNTIL Sbjct: 115 GCAWPPAGIQPIDPWEWPLVNTIL 138 Score = 42.7 bits (99), Expect(3) = 3e-09 Identities = 22/35 (62%), Positives = 23/35 (65%) Frame = -3 Query: 1286 LLWVYVIREGTFLGHHTVRVXXXXXXXXXLFIVSE 1182 L W VIREGTFLGHHT+RV LFIVSE Sbjct: 58 LWWADVIREGTFLGHHTLRVQRGLILGVILFIVSE 92 Score = 20.8 bits (42), Expect(3) = 3e-09 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -1 Query: 1318 HGGVLLTIG 1292 HGGV+LT+G Sbjct: 40 HGGVILTMG 48 >gb|AFN42482.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] Length = 270 Score = 51.2 bits (121), Expect(2) = 4e-09 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 1104 GCSWPPTSIQPIDPWELLLVNTIL 1033 GCSWPP IQPIDPWEL LVNTIL Sbjct: 116 GCSWPPAGIQPIDPWELPLVNTIL 139 Score = 40.4 bits (93), Expect(2) = 4e-09 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -3 Query: 1286 LLWVYVIREGT-FLGHHTVRVXXXXXXXXXLFIVSEI 1179 L W VIREGT FLGHHTVRV LFIVSE+ Sbjct: 58 LWWADVIREGTTFLGHHTVRVQQGLILGIILFIVSEV 94 >ref|YP_002587032.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus intraradices] gb|ACM45005.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus intraradices] gb|AFN42451.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AFN42513.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AMM72610.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] Length = 270 Score = 51.2 bits (121), Expect(2) = 4e-09 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 1104 GCSWPPTSIQPIDPWELLLVNTIL 1033 GCSWPP IQPIDPWEL LVNTIL Sbjct: 116 GCSWPPAGIQPIDPWELPLVNTIL 139 Score = 40.4 bits (93), Expect(2) = 4e-09 Identities = 23/37 (62%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -3 Query: 1286 LLWVYVIREGT-FLGHHTVRVXXXXXXXXXLFIVSEI 1179 L W VIREGT FLGHHTVRV LFIVSE+ Sbjct: 58 LWWADVIREGTTFLGHHTVRVQQGLILGIILFIVSEV 94 >dbj|GBC54036.1| Cytochrome c oxidase subunit III [Rhizophagus irregularis DAOM 181602] Length = 265 Score = 51.2 bits (121), Expect(2) = 2e-06 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -2 Query: 1104 GCSWPPTSIQPIDPWELLLVNTIL 1033 GCSWPP IQPIDPWEL LVNTIL Sbjct: 96 GCSWPPAGIQPIDPWELPLVNTIL 119 Score = 31.2 bits (69), Expect(2) = 2e-06 Identities = 19/36 (52%), Positives = 20/36 (55%) Frame = -3 Query: 1286 LLWVYVIREGTFLGHHTVRVXXXXXXXXXLFIVSEI 1179 L W VIREG HHTVRV LFIVSE+ Sbjct: 43 LWWADVIREG----HHTVRVQQGLILGIILFIVSEV 74