BLASTX nr result
ID: Ophiopogon26_contig00040137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00040137 (977 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC73836.1| hypothetical protein RhiirA1_238853 [Rhizophagus ... 54 5e-09 >gb|PKC73836.1| hypothetical protein RhiirA1_238853 [Rhizophagus irregularis] Length = 78 Score = 54.3 bits (129), Expect(2) = 5e-09 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = -3 Query: 696 GGNVFCTLLLNALQAFDSLLTIXXXXXXXXXXXXXXXSAVYKMDNK 559 GGNVFCTLLLNALQAFDSLLTI SAVYKM NK Sbjct: 11 GGNVFCTLLLNALQAFDSLLTILKSGTGLYLTSGLLLSAVYKMGNK 56 Score = 35.8 bits (81), Expect(2) = 5e-09 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 Query: 529 PYYFLSFIADVNSCTI 482 PYYFLSFI DVNSCTI Sbjct: 63 PYYFLSFIDDVNSCTI 78