BLASTX nr result
ID: Ophiopogon26_contig00039846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00039846 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264271.1| protein NRT1/ PTR FAMILY 4.6-like [Asparagus... 71 1e-11 gb|ONK68721.1| uncharacterized protein A4U43_C05F15210 [Asparagu... 71 1e-11 >ref|XP_020264271.1| protein NRT1/ PTR FAMILY 4.6-like [Asparagus officinalis] Length = 351 Score = 70.9 bits (172), Expect = 1e-11 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 422 FYWMLAVLSFVNLLIFLFWARWYQYRSPNSKARIRDES 309 FYWMLAVLSF+NLLIF+ WARWY+YRS NSK R+ DE+ Sbjct: 311 FYWMLAVLSFINLLIFMLWARWYKYRSQNSKVRVTDEN 348 >gb|ONK68721.1| uncharacterized protein A4U43_C05F15210 [Asparagus officinalis] Length = 398 Score = 70.9 bits (172), Expect = 1e-11 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -3 Query: 422 FYWMLAVLSFVNLLIFLFWARWYQYRSPNSKARIRDES 309 FYWMLAVLSF+NLLIF+ WARWY+YRS NSK R+ DE+ Sbjct: 358 FYWMLAVLSFINLLIFMLWARWYKYRSQNSKVRVTDEN 395