BLASTX nr result
ID: Ophiopogon26_contig00039770
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00039770 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY42764.1| hypothetical protein RhiirA4_540636 [Rhizophagus ... 72 2e-13 gb|PKY21354.1| hypothetical protein RhiirB3_524960 [Rhizophagus ... 72 2e-13 gb|PKK71200.1| hypothetical protein RhiirC2_849322 [Rhizophagus ... 72 3e-13 gb|EXX76087.1| hypothetical protein RirG_036360 [Rhizophagus irr... 70 7e-13 gb|PKY59713.1| hypothetical protein RhiirA4_449534, partial [Rhi... 72 2e-12 gb|PKB94029.1| hypothetical protein RhiirA5_439732, partial [Rhi... 70 2e-12 gb|PKC73863.1| hypothetical protein RhiirA1_450659 [Rhizophagus ... 70 2e-12 gb|PKC05793.1| hypothetical protein RhiirA5_360930, partial [Rhi... 70 2e-12 gb|PKK71198.1| hypothetical protein RhiirC2_745098, partial [Rhi... 70 3e-12 gb|PKY62876.1| hypothetical protein RhiirA4_551336, partial [Rhi... 68 3e-12 gb|PKY42752.1| hypothetical protein RhiirA4_442173 [Rhizophagus ... 72 5e-12 gb|PKC55209.1| hypothetical protein RhiirA1_504116 [Rhizophagus ... 72 5e-12 gb|PKC05794.1| hypothetical protein RhiirA5_501839, partial [Rhi... 71 6e-12 gb|POG77792.1| hypothetical protein GLOIN_2v1543763 [Rhizophagus... 72 6e-12 gb|PKY61869.1| hypothetical protein RhiirA4_551065 [Rhizophagus ... 71 7e-12 gb|PKY59961.1| hypothetical protein RhiirA4_550515 [Rhizophagus ... 72 8e-12 gb|PKY52032.1| hypothetical protein RhiirA4_546926 [Rhizophagus ... 71 1e-11 gb|PKB96526.1| hypothetical protein RhiirA5_506930 [Rhizophagus ... 72 1e-11 gb|PKY42761.1| hypothetical protein RhiirA4_540633 [Rhizophagus ... 72 2e-11 gb|PKB99649.1| hypothetical protein RhiirA5_505620, partial [Rhi... 69 2e-11 >gb|PKY42764.1| hypothetical protein RhiirA4_540636 [Rhizophagus irregularis] Length = 84 Score = 72.0 bits (175), Expect = 2e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 53 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 83 >gb|PKY21354.1| hypothetical protein RhiirB3_524960 [Rhizophagus irregularis] Length = 84 Score = 72.0 bits (175), Expect = 2e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 47 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 77 >gb|PKK71200.1| hypothetical protein RhiirC2_849322 [Rhizophagus irregularis] Length = 83 Score = 71.6 bits (174), Expect = 3e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FT+GNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 47 FTVGNDTFQEVVCHNERLGGNDEWCIELIKQ 77 >gb|EXX76087.1| hypothetical protein RirG_036360 [Rhizophagus irregularis DAOM 197198w] Length = 59 Score = 70.1 bits (170), Expect = 7e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCH+ERLGGNDEWCIELIKQ Sbjct: 28 FTIGNDTFQEVVCHSERLGGNDEWCIELIKQ 58 >gb|PKY59713.1| hypothetical protein RhiirA4_449534, partial [Rhizophagus irregularis] Length = 162 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 122 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 152 >gb|PKB94029.1| hypothetical protein RhiirA5_439732, partial [Rhizophagus irregularis] Length = 97 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCH+ERLGGNDEWCIELIKQ Sbjct: 57 FTIGNDTFQEVVCHDERLGGNDEWCIELIKQ 87 >gb|PKC73863.1| hypothetical protein RhiirA1_450659 [Rhizophagus irregularis] Length = 96 Score = 69.7 bits (169), Expect = 2e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 F +GNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 60 FNVGNDTFQEVVCHNERLGGNDEWCIELIKQ 90 >gb|PKC05793.1| hypothetical protein RhiirA5_360930, partial [Rhizophagus irregularis] Length = 96 Score = 69.7 bits (169), Expect = 2e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 F +GNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 60 FNVGNDTFQEVVCHNERLGGNDEWCIELIKQ 90 >gb|PKK71198.1| hypothetical protein RhiirC2_745098, partial [Rhizophagus irregularis] Length = 97 Score = 69.7 bits (169), Expect = 3e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 F +GNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 61 FNVGNDTFQEVVCHNERLGGNDEWCIELIKQ 91 >gb|PKY62876.1| hypothetical protein RhiirA4_551336, partial [Rhizophagus irregularis] Length = 54 Score = 68.2 bits (165), Expect = 3e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 F IGN+TFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 18 FNIGNNTFQEVVCHNERLGGNDEWCIELIKQ 48 >gb|PKY42752.1| hypothetical protein RhiirA4_442173 [Rhizophagus irregularis] Length = 207 Score = 71.6 bits (174), Expect = 5e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FT+GNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 171 FTVGNDTFQEVVCHNERLGGNDEWCIELIKQ 201 >gb|PKC55209.1| hypothetical protein RhiirA1_504116 [Rhizophagus irregularis] Length = 232 Score = 72.0 bits (175), Expect = 5e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 194 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 224 >gb|PKC05794.1| hypothetical protein RhiirA5_501839, partial [Rhizophagus irregularis] Length = 201 Score = 71.2 bits (173), Expect = 6e-12 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FT+GNDTFQE+VCHNERLGGNDEWCIELIKQ Sbjct: 165 FTVGNDTFQEIVCHNERLGGNDEWCIELIKQ 195 >gb|POG77792.1| hypothetical protein GLOIN_2v1543763 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 244 Score = 72.0 bits (175), Expect = 6e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 206 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 236 >gb|PKY61869.1| hypothetical protein RhiirA4_551065 [Rhizophagus irregularis] Length = 210 Score = 71.2 bits (173), Expect = 7e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQA 459 FTIGND FQEV+CHNERLGGNDEWCIELIKQA Sbjct: 174 FTIGNDAFQEVICHNERLGGNDEWCIELIKQA 205 >gb|PKY59961.1| hypothetical protein RhiirA4_550515 [Rhizophagus irregularis] Length = 232 Score = 71.6 bits (174), Expect = 8e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FT+GNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 196 FTVGNDTFQEVVCHNERLGGNDEWCIELIKQ 226 >gb|PKY52032.1| hypothetical protein RhiirA4_546926 [Rhizophagus irregularis] Length = 236 Score = 71.2 bits (173), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQA 459 FTIGND FQEV+CHNERLGGNDEWCIELIKQA Sbjct: 197 FTIGNDAFQEVICHNERLGGNDEWCIELIKQA 228 >gb|PKB96526.1| hypothetical protein RhiirA5_506930 [Rhizophagus irregularis] Length = 313 Score = 72.0 bits (175), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 273 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 303 >gb|PKY42761.1| hypothetical protein RhiirA4_540633 [Rhizophagus irregularis] Length = 334 Score = 72.0 bits (175), Expect = 2e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ Sbjct: 303 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 333 >gb|PKB99649.1| hypothetical protein RhiirA5_505620, partial [Rhizophagus irregularis] Length = 159 Score = 69.3 bits (168), Expect = 2e-11 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 554 FTIGNDTFQEVVCHNERLGGNDEWCIELIKQ 462 F+IGNDTFQE+VCHNERLGGNDEWCIELIKQ Sbjct: 128 FSIGNDTFQELVCHNERLGGNDEWCIELIKQ 158