BLASTX nr result
ID: Ophiopogon26_contig00039737
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00039737 (621 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC42362.1| hypothetical protein RIR_2558200 [Rhizophagus ir... 140 2e-39 >dbj|GBC42362.1| hypothetical protein RIR_2558200 [Rhizophagus irregularis DAOM 181602] gb|PKC12801.1| hypothetical protein RhiirA5_352523 [Rhizophagus irregularis] gb|PKC68017.1| hypothetical protein RhiirA1_417379 [Rhizophagus irregularis] gb|PKY18041.1| hypothetical protein RhiirB3_405039 [Rhizophagus irregularis] gb|PKY38324.1| hypothetical protein RhiirA4_391803 [Rhizophagus irregularis] Length = 99 Score = 140 bits (352), Expect = 2e-39 Identities = 67/83 (80%), Positives = 70/83 (84%) Frame = +1 Query: 118 MSQVQEGGDEDYFDPMAMDEYEDGQLDGTAGPSYHPQSSYMREXXXXXXXXXXYDESFFP 297 MSQ+ EG D+DYFDPMAMDEYEDGQLDGTAGPSYHPQSSYMRE Y+ESFFP Sbjct: 1 MSQMPEG-DDDYFDPMAMDEYEDGQLDGTAGPSYHPQSSYMREGSSHHGHHGGYEESFFP 59 Query: 298 SPTHPHHKGGAHHRQNQQGDKTV 366 SP HPHHKGGAHHRQNQQGDKTV Sbjct: 60 SP-HPHHKGGAHHRQNQQGDKTV 81