BLASTX nr result
ID: Ophiopogon26_contig00039444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00039444 (748 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC44717.1| Tis13_84468 [Rhizophagus irregularis DAOM 181602] 230 7e-74 gb|PKK78655.1| hypothetical protein RhiirC2_729065 [Rhizophagus ... 150 3e-43 >dbj|GBC44717.1| Tis13_84468 [Rhizophagus irregularis DAOM 181602] Length = 136 Score = 230 bits (586), Expect = 7e-74 Identities = 115/131 (87%), Positives = 122/131 (93%), Gaps = 2/131 (1%) Frame = +3 Query: 108 MSEVIRKFLKGCEEALNWVKSKFLKSQISDSLSEKKRNVV--QPFNPPPVMNLMLRSILN 281 MSEVIRKFLKGCEEALNWVK+KFL QISDSLSEKKR+VV Q FNPPPVMN+M+RSILN Sbjct: 1 MSEVIRKFLKGCEEALNWVKTKFLNPQISDSLSEKKRDVVVVQRFNPPPVMNVMIRSILN 60 Query: 282 QKPLYQLIKAPKLPIYSSGVDRELYSIMNQKPQDEFQRRFRPSSNMNKLPQYKRSVKRPA 461 QKPLYQLIKAP+ PI SS VDRELYSIMNQKPQDEFQR F+PSSNMNKLPQYKRSVKRP+ Sbjct: 61 QKPLYQLIKAPRRPINSSSVDRELYSIMNQKPQDEFQRGFKPSSNMNKLPQYKRSVKRPS 120 Query: 462 MKNRQHSRYFR 494 MKNRQHSRYFR Sbjct: 121 MKNRQHSRYFR 131 >gb|PKK78655.1| hypothetical protein RhiirC2_729065 [Rhizophagus irregularis] Length = 81 Score = 150 bits (379), Expect = 3e-43 Identities = 73/81 (90%), Positives = 77/81 (95%) Frame = +3 Query: 252 MNLMLRSILNQKPLYQLIKAPKLPIYSSGVDRELYSIMNQKPQDEFQRRFRPSSNMNKLP 431 MN+MLRSILNQKPL+QLIKAP+ PI SS VDRELYSIMNQKPQDEFQR F+PSSNMNKLP Sbjct: 1 MNVMLRSILNQKPLFQLIKAPRRPINSSSVDRELYSIMNQKPQDEFQRGFKPSSNMNKLP 60 Query: 432 QYKRSVKRPAMKNRQHSRYFR 494 QYKRSVKRPAMKNRQHSRYFR Sbjct: 61 QYKRSVKRPAMKNRQHSRYFR 81