BLASTX nr result
ID: Ophiopogon26_contig00039285
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00039285 (534 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242445.1| early nodulin-93-like [Asparagus officinalis] 55 1e-06 >ref|XP_020242445.1| early nodulin-93-like [Asparagus officinalis] Length = 98 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 4 VAGAAYFIVADKTVQALARKNSFKNSHLANMKS 102 VAGAAYFIVADKTV A ARKNSFKN+ LAN+K+ Sbjct: 66 VAGAAYFIVADKTVLASARKNSFKNTQLANIKA 98