BLASTX nr result
ID: Ophiopogon26_contig00039250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00039250 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020277414.1| uncharacterized protein LOC109851599 [Aspara... 59 3e-07 >ref|XP_020277414.1| uncharacterized protein LOC109851599 [Asparagus officinalis] ref|XP_020277418.1| uncharacterized protein LOC109851599 [Asparagus officinalis] gb|ONK79623.1| uncharacterized protein A4U43_C01F8260 [Asparagus officinalis] Length = 2769 Score = 58.5 bits (140), Expect = 3e-07 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +1 Query: 118 MASSARSGRVLRHEGTSSSTRGGNATAKVKNINDSPTSGSKAIGTKSRASNGT 276 M S RSGR+L+ EGTSS T+ G+A AKVK+ DSPTS S A TK++A+N T Sbjct: 1 MTSCTRSGRILKQEGTSS-TKSGDAAAKVKDTKDSPTSRSTATTTKNKANNTT 52