BLASTX nr result
ID: Ophiopogon26_contig00039031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00039031 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77492.1| uncharacterized protein A4U43_C02F7120 [Asparagus... 63 8e-10 gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus... 63 5e-09 gb|ONK67985.1| uncharacterized protein A4U43_C05F5960 [Asparagus... 54 6e-06 >gb|ONK77492.1| uncharacterized protein A4U43_C02F7120 [Asparagus officinalis] Length = 126 Score = 62.8 bits (151), Expect = 8e-10 Identities = 23/47 (48%), Positives = 37/47 (78%) Frame = -3 Query: 142 KVNHIELLAAWHAILWFYKKYGSALLWLDGDSLRVVELLNRIPHHND 2 +VN+ EL+ AW A+ W YK+YG+ L+W++GDS V++LL++ P+H D Sbjct: 52 EVNYAELIGAWSALTWCYKRYGACLVWIEGDSKHVLDLLSKEPYHTD 98 >gb|ONK57668.1| uncharacterized protein A4U43_C09F2850 [Asparagus officinalis] Length = 229 Score = 62.8 bits (151), Expect = 5e-09 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = -3 Query: 142 KVNHIELLAAWHAILWFYKKYGSALLWLDGDSLRVVELLNRIPHHND 2 KVN+ EL+ AW A+ W YK+YG+ L+W+ GDS V++LL++ P+H D Sbjct: 114 KVNYAELIVAWSALTWCYKRYGACLVWIAGDSKHVLDLLSKEPYHTD 160 >gb|ONK67985.1| uncharacterized protein A4U43_C05F5960 [Asparagus officinalis] Length = 231 Score = 54.3 bits (129), Expect = 6e-06 Identities = 20/43 (46%), Positives = 33/43 (76%) Frame = -3 Query: 142 KVNHIELLAAWHAILWFYKKYGSALLWLDGDSLRVVELLNRIP 14 +VN+ EL+ W A+ W YK+YG+ L+W++GDS V++LL++ P Sbjct: 147 EVNYAELIGDWSALTWCYKRYGTCLVWIEGDSKHVLDLLSKDP 189