BLASTX nr result
ID: Ophiopogon26_contig00038908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038908 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA10833.1| Reverse transcriptase zinc-binding domain [Maclea... 55 4e-06 gb|OVA18506.1| Reverse transcriptase zinc-binding domain [Maclea... 55 5e-06 >gb|OVA10833.1| Reverse transcriptase zinc-binding domain [Macleaya cordata] Length = 314 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 4/83 (4%) Frame = -3 Query: 379 PGSMMVLLSDWRDHHISNNVKLEWDMSVLAITWQIWREKNQRLFHHKFRNSLS----ILS 212 PGS++ L W H S KL W +I W IW E+N+R+F +K ++ ++ + S Sbjct: 232 PGSVISLAHSWSSHGFSKTGKLLWQFVPASIFWVIWLERNRRIFDNKSKDPIALSHEVKS 291 Query: 211 YVHFFVSFWLQNIPIKLWRIFLN 143 +HF+VS +++ I L N Sbjct: 292 LIHFWVSSHYRDLKIPLHSFIFN 314 >gb|OVA18506.1| Reverse transcriptase zinc-binding domain [Macleaya cordata] Length = 649 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 4/83 (4%) Frame = -3 Query: 379 PGSMMVLLSDWRDHHISNNVKLEWDMSVLAITWQIWREKNQRLFHHKFRNSLS----ILS 212 PGS++ L W H S KL W +I W IW E+N+R+F +K ++ ++ + S Sbjct: 567 PGSVISLAHSWSSHGFSKTGKLLWQFVPASIFWVIWLERNRRIFDNKSKDPIALSHEVKS 626 Query: 211 YVHFFVSFWLQNIPIKLWRIFLN 143 +HF+VS +++ I L N Sbjct: 627 LIHFWVSSHYRDLKIPLHSFIFN 649