BLASTX nr result
ID: Ophiopogon26_contig00038871
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038871 (609 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242946.1| uncharacterized protein LOC109821168 [Aspara... 60 5e-07 ref|XP_020243014.1| zinc finger CCHC domain-containing protein 9... 54 5e-06 emb|CEF61611.1| Reverse transcriptase domain and Integrase, cata... 57 8e-06 >ref|XP_020242946.1| uncharacterized protein LOC109821168 [Asparagus officinalis] Length = 348 Score = 59.7 bits (143), Expect = 5e-07 Identities = 30/82 (36%), Positives = 40/82 (48%), Gaps = 3/82 (3%) Frame = -3 Query: 445 CGYCKKSRHFKRDCRRKHGLCLRCGAKDHQVANCLSKHQEYPILALPTLPLSLI---PVQ 275 C YCKK H +DCR+ +GLCL CGA DHQ+ C S+ +P Q Sbjct: 3 CHYCKKPGHLMKDCRKANGLCLICGAADHQLTTCPSRRVSGEASGGTIVPAGQARQDVQQ 62 Query: 274 ARSLTPSQDQVRQQTERNKSRY 209 R P+Q Q+ Q +R +Y Sbjct: 63 RRPALPTQQQMFQNQQRRSGQY 84 >ref|XP_020243014.1| zinc finger CCHC domain-containing protein 9-like [Asparagus officinalis] Length = 101 Score = 53.5 bits (127), Expect = 5e-06 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = -3 Query: 445 CGYCKKSRHFKRDCRRKHGLCLRCGAKDHQVANCLSK 335 C +C K H +DCRR +GLCL CG DHQ+ C S+ Sbjct: 50 CHFCSKPGHLMKDCRRANGLCLACGVADHQITTCTSR 86 >emb|CEF61611.1| Reverse transcriptase domain and Integrase, catalytic core domain and Zinc finger, CCHC-type domain and Peptidase A2A, retrovirus, catalytic domain and Ribonuclease H-like domain and Peptidase A2A, retrovirus RVP subgroup domain and Aspartic peptidase domain-containing protein [Strongyloides ratti] Length = 1333 Score = 56.6 bits (135), Expect = 8e-06 Identities = 22/42 (52%), Positives = 29/42 (69%) Frame = -3 Query: 445 CGYCKKSRHFKRDCRRKHGLCLRCGAKDHQVANCLSKHQEYP 320 C YCKKS H +CRRK+G CLRCGA DH++ C ++ + P Sbjct: 161 CSYCKKSNHTVDNCRRKNGECLRCGAGDHKLNECSQRNSKSP 202