BLASTX nr result
ID: Ophiopogon26_contig00038767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038767 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX66295.1| hypothetical protein RirG_125240 [Rhizophagus irr... 60 1e-07 gb|PKY44584.1| hypothetical protein RhiirA4_400064 [Rhizophagus ... 60 1e-07 >gb|EXX66295.1| hypothetical protein RirG_125240 [Rhizophagus irregularis DAOM 197198w] dbj|GBC26681.1| homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein [Rhizophagus irregularis DAOM 181602] gb|PKC05915.1| hypothetical protein RhiirA5_360731 [Rhizophagus irregularis] gb|PKC69099.1| hypothetical protein RhiirA1_416154 [Rhizophagus irregularis] gb|PKY18484.1| hypothetical protein RhiirB3_405645 [Rhizophagus irregularis] gb|POG73270.1| hypothetical protein GLOIN_2v1587899 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 422 Score = 60.1 bits (144), Expect = 1e-07 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 284 PQQEN-RSITLQDIEHALWTFVASLIPTNAPDVAQDDVGM 168 PQQEN RSITLQDIEHALWTFVASLIPTN Q++VGM Sbjct: 385 PQQENGRSITLQDIEHALWTFVASLIPTNV--AQQEEVGM 422 >gb|PKY44584.1| hypothetical protein RhiirA4_400064 [Rhizophagus irregularis] Length = 424 Score = 60.1 bits (144), Expect = 1e-07 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 284 PQQEN-RSITLQDIEHALWTFVASLIPTNAPDVAQDDVGM 168 PQQEN RSITLQDIEHALWTFVASLIPTN Q++VGM Sbjct: 387 PQQENGRSITLQDIEHALWTFVASLIPTNV--AQQEEVGM 424