BLASTX nr result
ID: Ophiopogon26_contig00038615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038615 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJY66653.1| hypothetical protein OXYTRI_13058 (macronuclear) ... 54 9e-06 gb|EJY65597.1| hypothetical protein OXYTRI_14248 (macronuclear) ... 54 9e-06 >gb|EJY66653.1| hypothetical protein OXYTRI_13058 (macronuclear) [Oxytricha trifallax] Length = 1367 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 301 YQRREPGVPLVLPWITVTTARH*EGKTNLSHDGL 402 YQ EP VPLVL WITV T+ H +GKTNLSHDGL Sbjct: 110 YQLSEPTVPLVLSWITVATSLHQQGKTNLSHDGL 143 >gb|EJY65597.1| hypothetical protein OXYTRI_14248 (macronuclear) [Oxytricha trifallax] Length = 1367 Score = 54.3 bits (129), Expect = 9e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 301 YQRREPGVPLVLPWITVTTARH*EGKTNLSHDGL 402 YQ EP VPLVL WITV T+ H +GKTNLSHDGL Sbjct: 110 YQLSEPTVPLVLSWITVATSLHQQGKTNLSHDGL 143