BLASTX nr result
ID: Ophiopogon26_contig00038598
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038598 (585 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKB93698.1| hypothetical protein RhiirA5_303770, partial [Rhi... 67 8e-12 dbj|GAO47198.1| hypothetical protein G7K_1408-t1 [Saitoella comp... 63 2e-08 ref|XP_018712500.1| hypothetical protein METBIDRAFT_39660, parti... 59 3e-08 ref|XP_018709242.1| hypothetical protein METBIDRAFT_48173, parti... 59 3e-08 gb|KDR65248.1| hypothetical protein GALMADRAFT_82091, partial [G... 57 1e-07 gb|PLB42760.1| hypothetical protein P170DRAFT_318282, partial [A... 57 1e-07 gb|OCK86492.1| hypothetical protein K441DRAFT_599513, partial [C... 57 1e-07 ref|XP_013955650.1| hypothetical protein TRIVIDRAFT_53758, parti... 57 1e-07 gb|PKB93993.1| hypothetical protein RhiirA5_303627, partial [Rhi... 56 2e-07 gb|PLB42834.1| hypothetical protein P170DRAFT_371375, partial [A... 57 3e-07 ref|XP_001624693.1| predicted protein [Nematostella vectensis] >... 57 4e-07 dbj|GBC51275.1| Tis13_67334, partial [Rhizophagus irregularis DA... 56 5e-07 gb|PMD11938.1| hypothetical protein NA56DRAFT_683555 [Pezoloma e... 57 9e-07 gb|PHT28712.1| hypothetical protein CQW23_31691 [Capsicum baccatum] 57 1e-06 ref|XP_001891759.1| alpha-L1 nicotinic acetyl choline receptor [... 54 1e-06 ref|XP_001893546.1| unspecific monooxygenase [Brugia malayi] 54 1e-06 ref|XP_001891797.1| rRNA promoter binding protein [Brugia malayi] 54 2e-06 gb|PHT25617.1| hypothetical protein CQW23_34758 [Capsicum baccatum] 54 3e-06 gb|OBZ64685.1| hypothetical protein A0H81_15002, partial [Grifol... 57 4e-06 gb|PHT24965.1| hypothetical protein CQW23_35381 [Capsicum baccatum] 55 6e-06 >gb|PKB93698.1| hypothetical protein RhiirA5_303770, partial [Rhizophagus irregularis] gb|PKY60810.1| hypothetical protein RhiirA4_333626, partial [Rhizophagus irregularis] Length = 52 Score = 67.4 bits (163), Expect = 8e-12 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = -3 Query: 136 SFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKSL 2 SFSQ+Y S+LP S TYIVLS R CSPWRPA VMSTTR ENKSL Sbjct: 3 SFSQSYGSVLPTSLTYIVLSTR--GCSPWRPAAVMSTTRYENKSL 45 >dbj|GAO47198.1| hypothetical protein G7K_1408-t1 [Saitoella complicata NRRL Y-17804] Length = 309 Score = 63.2 bits (152), Expect = 2e-08 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = -3 Query: 148 NKDSSFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKSL 2 N+ SFS++Y SILP S YIVLS R CSPWRPA VMSTT EN+SL Sbjct: 235 NQSQSFSRSYGSILPTSLIYIVLSTR--GCSPWRPAAVMSTTGHENESL 281 >ref|XP_018712500.1| hypothetical protein METBIDRAFT_39660, partial [Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993] gb|OBA22004.1| hypothetical protein METBIDRAFT_39660, partial [Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993] Length = 63 Score = 58.5 bits (140), Expect = 3e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 132 FPKITNLFCRLPLPTLFYQLECSVVHLGDLLWL*VRLGVKINLS 1 +P++T+LFCRLPL TLFYQLE V+LGDLL + VRLG+K+N S Sbjct: 8 YPEVTDLFCRLPLSTLFYQLE--AVNLGDLLRISVRLGMKVNPS 49 >ref|XP_018709242.1| hypothetical protein METBIDRAFT_48173, partial [Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993] gb|OBA16136.1| hypothetical protein METBIDRAFT_48173, partial [Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993] Length = 63 Score = 58.5 bits (140), Expect = 3e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 132 FPKITNLFCRLPLPTLFYQLECSVVHLGDLLWL*VRLGVKINLS 1 +P++T+LFCRLPL TLFYQLE V+LGDLL + VRLG+K+N S Sbjct: 8 YPEVTDLFCRLPLSTLFYQLE--AVNLGDLLRISVRLGMKVNPS 49 >gb|KDR65248.1| hypothetical protein GALMADRAFT_82091, partial [Galerina marginata CBS 339.88] Length = 82 Score = 57.4 bits (137), Expect = 1e-07 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -3 Query: 136 SFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKS 5 SFS++Y SILP S YIVLS R CSPWRPA VMSTTR E+ S Sbjct: 3 SFSRSYGSILPTSLIYIVLSTR--GCSPWRPAAVMSTTRCESYS 44 >gb|PLB42760.1| hypothetical protein P170DRAFT_318282, partial [Aspergillus steynii IBT 23096] gb|PLB43050.1| hypothetical protein P170DRAFT_316851, partial [Aspergillus steynii IBT 23096] Length = 82 Score = 57.0 bits (136), Expect = 1e-07 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -3 Query: 136 SFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKS 5 S S++Y SILP S YIVLS R CSPWRPA VMSTT REN S Sbjct: 3 SLSRSYGSILPTSLIYIVLSTR--GCSPWRPAAVMSTTWRENYS 44 >gb|OCK86492.1| hypothetical protein K441DRAFT_599513, partial [Cenococcum geophilum 1.58] Length = 82 Score = 57.0 bits (136), Expect = 1e-07 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = -3 Query: 136 SFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKS 5 SFS++Y SILP S YIVLS R F SPWRPA VMSTT REN S Sbjct: 3 SFSRSYGSILPTSLIYIVLSTRGF--SPWRPAAVMSTTWRENYS 44 >ref|XP_013955650.1| hypothetical protein TRIVIDRAFT_53758, partial [Trichoderma virens Gv29-8] gb|EHK21457.1| hypothetical protein TRIVIDRAFT_53758, partial [Trichoderma virens Gv29-8] Length = 82 Score = 57.0 bits (136), Expect = 1e-07 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -3 Query: 136 SFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKS 5 S S++Y SILP S YIVLS R CSPWRPA VMSTT REN S Sbjct: 3 SLSRSYGSILPTSLIYIVLSTR--GCSPWRPAAVMSTTWRENYS 44 >gb|PKB93993.1| hypothetical protein RhiirA5_303627, partial [Rhizophagus irregularis] gb|PKC00567.1| hypothetical protein RhiirA5_299154, partial [Rhizophagus irregularis] gb|PKK74464.1| hypothetical protein RhiirC2_648022, partial [Rhizophagus irregularis] gb|PKY22566.1| hypothetical protein RhiirB3_333361, partial [Rhizophagus irregularis] Length = 59 Score = 55.8 bits (133), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 132 FPKITNLFCRLPLPTLFYQLECSVVHLGDLLWL 34 FPK+T+LFCRLPLPTLFYQLE VHLGDLL L Sbjct: 29 FPKVTDLFCRLPLPTLFYQLE--AVHLGDLLRL 59 >gb|PLB42834.1| hypothetical protein P170DRAFT_371375, partial [Aspergillus steynii IBT 23096] Length = 113 Score = 57.0 bits (136), Expect = 3e-07 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -3 Query: 136 SFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKS 5 S S++Y SILP S YIVLS R CSPWRPA VMSTT REN S Sbjct: 3 SLSRSYGSILPTSLIYIVLSTR--GCSPWRPAAVMSTTWRENYS 44 >ref|XP_001624693.1| predicted protein [Nematostella vectensis] gb|EDO32593.1| predicted protein, partial [Nematostella vectensis] Length = 123 Score = 57.0 bits (136), Expect = 4e-07 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -1 Query: 132 FPKITNLFCRLPLPTLFYQLECSVVHLGDLLWL*VRLGVKINL 4 FP++T+LFCRLPLPTLFYQ E + HLGDLL L VR KIN+ Sbjct: 70 FPEVTDLFCRLPLPTLFYQPEAA--HLGDLLRLLVRPDTKINV 110 >dbj|GBC51275.1| Tis13_67334, partial [Rhizophagus irregularis DAOM 181602] Length = 88 Score = 55.8 bits (133), Expect = 5e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 132 FPKITNLFCRLPLPTLFYQLECSVVHLGDLLWL 34 FPK+T+LFCRLPLPTLFYQLE VHLGDLL L Sbjct: 58 FPKVTDLFCRLPLPTLFYQLE--AVHLGDLLRL 88 >gb|PMD11938.1| hypothetical protein NA56DRAFT_683555 [Pezoloma ericae] Length = 191 Score = 57.4 bits (137), Expect = 9e-07 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -3 Query: 136 SFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKS 5 SFS++Y SILP S YIVLS R CSPWRPA VMSTT RE+ S Sbjct: 37 SFSRSYGSILPTSLIYIVLSTR--GCSPWRPAAVMSTTWRESYS 78 >gb|PHT28712.1| hypothetical protein CQW23_31691 [Capsicum baccatum] Length = 167 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -3 Query: 136 SFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKSL 2 SFSQ+YESILP S TYIV S R CSPWRP +MSTT R S+ Sbjct: 105 SFSQSYESILPTSLTYIVPSTR--GCSPWRPDAIMSTTGRGRHSV 147 >ref|XP_001891759.1| alpha-L1 nicotinic acetyl choline receptor [Brugia malayi] ref|XP_001892385.1| alpha-L1 nicotinic acetyl choline receptor [Brugia malayi] ref|XP_001893700.1| alpha-L1 nicotinic acetyl choline receptor [Brugia malayi] ref|XP_001894198.1| alpha-L1 nicotinic acetyl choline receptor [Brugia malayi] Length = 61 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 132 FPKITNLFCRLPLPTLFYQLECSVVHLGDLLWL*VRLGVK 13 +P++T+L CRLPLPTLFY+LE VHLGDLL + VR G K Sbjct: 22 YPEVTDLICRLPLPTLFYRLE--AVHLGDLLRIWVRSGTK 59 >ref|XP_001893546.1| unspecific monooxygenase [Brugia malayi] Length = 65 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 132 FPKITNLFCRLPLPTLFYQLECSVVHLGDLLWL*VRLGVK 13 +P++T+L CRLPLPTLFY+LE VHLGDLL + VR G K Sbjct: 26 YPEVTDLICRLPLPTLFYRLE--AVHLGDLLRIWVRSGTK 63 >ref|XP_001891797.1| rRNA promoter binding protein [Brugia malayi] Length = 81 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 132 FPKITNLFCRLPLPTLFYQLECSVVHLGDLLWL*VRLGVK 13 +P++T+L CRLPLPTLFY+LE VHLGDLL + VR G K Sbjct: 42 YPEVTDLICRLPLPTLFYRLE--AVHLGDLLRIWVRSGTK 79 >gb|PHT25617.1| hypothetical protein CQW23_34758 [Capsicum baccatum] Length = 106 Score = 54.3 bits (129), Expect = 3e-06 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -3 Query: 142 DSSFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKSL 2 + FSQ+YESILP S YIV S R CSPWRP +VMSTT R S+ Sbjct: 30 EQXFSQSYESILPTSLAYIVPSTR--GCSPWRPDMVMSTTGRGRHSV 74 >gb|OBZ64685.1| hypothetical protein A0H81_15002, partial [Grifola frondosa] Length = 596 Score = 57.0 bits (136), Expect = 4e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -3 Query: 127 QNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKS 5 ++Y SILP S YIVLS R CSPWRPA VMSTTRREN S Sbjct: 195 RHYGSILPTSLIYIVLSTR--GCSPWRPAAVMSTTRRENYS 233 >gb|PHT24965.1| hypothetical protein CQW23_35381 [Capsicum baccatum] Length = 186 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/48 (60%), Positives = 31/48 (64%) Frame = -3 Query: 145 KDSSFSQNYESILPASFTYIVLSIRMFSCSPWRPAVVMSTTRRENKSL 2 + SFSQ YESILP S YIV S R CSPWRP VMSTT R S+ Sbjct: 99 QSQSFSQTYESILPTSLAYIVPSTR--GCSPWRPDAVMSTTGRGRHSV 144