BLASTX nr result
ID: Ophiopogon26_contig00038521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038521 (564 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX56443.1| hypothetical protein RirG_216210 [Rhizophagus irr... 146 2e-42 gb|PKB98339.1| hypothetical protein RhiirA5_431522 [Rhizophagus ... 121 7e-33 >gb|EXX56443.1| hypothetical protein RirG_216210 [Rhizophagus irregularis DAOM 197198w] dbj|GBC43899.1| JEMT01027715.1_cds_EXX56443.1_23589 [Rhizophagus irregularis DAOM 181602] Length = 77 Score = 146 bits (368), Expect = 2e-42 Identities = 71/77 (92%), Positives = 75/77 (97%) Frame = +3 Query: 90 MKFTTTKVAITIFMLLAYIAVVSQALGIKNGGGYVREFQAKHKKLMHDLRKTVDELDHRM 269 MKFTTTKVAITIFMLLAYIA+VSQA+GIKNGGGYV+EFQAKHKKLMHDLRKTVDELDHRM Sbjct: 1 MKFTTTKVAITIFMLLAYIAIVSQAIGIKNGGGYVQEFQAKHKKLMHDLRKTVDELDHRM 60 Query: 270 EVFKTRMEAYHEVGATL 320 EVFK RME YHEVGAT+ Sbjct: 61 EVFKKRMEFYHEVGATV 77 >gb|PKB98339.1| hypothetical protein RhiirA5_431522 [Rhizophagus irregularis] gb|PKC65214.1| hypothetical protein RhiirA1_461342 [Rhizophagus irregularis] Length = 70 Score = 121 bits (304), Expect = 7e-33 Identities = 60/70 (85%), Positives = 63/70 (90%) Frame = +3 Query: 90 MKFTTTKVAITIFMLLAYIAVVSQALGIKNGGGYVREFQAKHKKLMHDLRKTVDELDHRM 269 MKFTTTKVAITIFMLLAYIA+VSQA+GIKNGGGYV+EFQAKHKKLMHDLRKTVDELDHRM Sbjct: 1 MKFTTTKVAITIFMLLAYIAIVSQAIGIKNGGGYVQEFQAKHKKLMHDLRKTVDELDHRM 60 Query: 270 EVFKTRMEAY 299 E M Y Sbjct: 61 EYNSFHMFVY 70