BLASTX nr result
ID: Ophiopogon26_contig00038416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038416 (643 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265530.1| centromere/kinetochore protein zw10 homolog ... 60 8e-07 >ref|XP_020265530.1| centromere/kinetochore protein zw10 homolog [Asparagus officinalis] gb|ONK70268.1| uncharacterized protein A4U43_C05F31980 [Asparagus officinalis] Length = 734 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +2 Query: 92 KSKVRSYVLSHRHDFAAIFSLVAASDDSYAVLTDTIASTFCLLEARPLD 238 KS+VRSYVLSHR DFA+IFSL A+S S A L+D++A LL RPLD Sbjct: 21 KSRVRSYVLSHRDDFASIFSLSASSSASVASLSDSLADALRLLSDRPLD 69