BLASTX nr result
ID: Ophiopogon26_contig00038136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038136 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244799.1| uncharacterized protein LOC109822933 [Aspara... 59 8e-08 >ref|XP_020244799.1| uncharacterized protein LOC109822933 [Asparagus officinalis] ref|XP_020244800.1| uncharacterized protein LOC109822933 [Asparagus officinalis] gb|ONK60547.1| uncharacterized protein A4U43_C08F19740 [Asparagus officinalis] Length = 233 Score = 59.3 bits (142), Expect = 8e-08 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = +3 Query: 165 EENKPAKEESDELQTDEIVVNGECLSMYDDSCSVSDENLEKSSRALEKSDCSV 323 EE KEE EL+TDEIV+NGEC S+ D+CS+S+ENLE SR + S CSV Sbjct: 88 EEADTVKEEISELKTDEIVLNGECPSIEKDNCSISNENLENLSRD-QNSHCSV 139