BLASTX nr result
ID: Ophiopogon26_contig00038016
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00038016 (1835 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX70534.1| ribosomal 40S subunit protein S29A [Rhizophagus i... 125 3e-31 dbj|GBC53838.1| JEMT01016576.1_cds_EXX70534.1_9498, partial [Rhi... 121 1e-29 ref|XP_016609878.1| 40S ribosomal protein S29 [Spizellomyces pun... 113 7e-27 gb|ORX89665.1| ribosomal protein S14 [Basidiobolus meristosporus... 108 4e-25 gb|ODQ71702.1| hypothetical protein LIPSTDRAFT_73432 [Lipomyces ... 107 8e-25 emb|CCX29580.1| Similar to 40S ribosomal protein S29; acc. no. Q... 107 1e-24 gb|EWC48588.1| 40S ribosomal protein S29 [Drechslerella stenobro... 107 1e-24 gb|ORZ25871.1| 40S ribosomal protein S29 [Absidia repens] 106 2e-24 gb|KXN65685.1| ribosomal protein S14 [Conidiobolus coronatus NRR... 106 2e-24 gb|EPS33243.1| hypothetical protein PDE_08205 [Penicillium oxali... 106 2e-24 gb|EJT97456.1| ribosomal protein S14 [Dacryopinax primogenitus] ... 106 2e-24 gb|ORY03439.1| ribosomal protein S14 [Basidiobolus meristosporus... 106 3e-24 gb|KZT53861.1| ribosomal protein S14 [Calocera cornea HHB12733] 106 3e-24 emb|CDM37799.1| 40S ribosomal protein S29 [Penicillium roquefort... 106 3e-24 ref|XP_002148243.1| 40S ribosomal protein S29 [Talaromyces marne... 106 3e-24 gb|OCK93126.1| hypothetical protein K441DRAFT_567174 [Cenococcum... 106 3e-24 ref|XP_002564200.1| Pc22g01560 [Penicillium rubens Wisconsin 54-... 105 4e-24 gb|ORZ18851.1| ribosomal protein S14p/S29e-domain-containing pro... 106 4e-24 gb|ORZ11472.1| 40S ribosomal protein S29 [Absidia repens] >gi|11... 105 5e-24 ref|XP_022491167.1| hypothetical protein PENARI_c004G05912 [Peni... 105 5e-24 >gb|EXX70534.1| ribosomal 40S subunit protein S29A [Rhizophagus irregularis DAOM 197198w] gb|PKC02778.1| putative 40S ribosomal protein S29 [Rhizophagus irregularis] gb|PKC14326.1| putative 40S ribosomal protein S29 [Rhizophagus irregularis] gb|PKC73336.1| putative 40S ribosomal protein S29 [Rhizophagus irregularis] gb|PKK70455.1| putative 40S ribosomal protein S29 [Rhizophagus irregularis] gb|PKY23626.1| putative 40S ribosomal protein S29 [Rhizophagus irregularis] gb|PKY47924.1| putative 40S ribosomal protein S29 [Rhizophagus irregularis] gb|POG75085.1| putative 40S ribosomal protein S29 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 56 Score = 125 bits (315), Expect = 3e-31 Identities = 56/56 (100%), Positives = 56/56 (100%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR Sbjct: 1 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 56 >dbj|GBC53838.1| JEMT01016576.1_cds_EXX70534.1_9498, partial [Rhizophagus irregularis DAOM 181602] Length = 54 Score = 121 bits (303), Expect = 1e-29 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIK 1374 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIK Sbjct: 1 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIK 54 >ref|XP_016609878.1| 40S ribosomal protein S29 [Spizellomyces punctatus DAOM BR117] gb|KND01839.1| 40S ribosomal protein S29 [Spizellomyces punctatus DAOM BR117] Length = 56 Score = 113 bits (283), Expect = 7e-27 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAH VWFS PR+YGKGSR+CRVCAH+AGLIRKYNLN+CRQCFREYS+DIGFIKYR Sbjct: 1 MAHSAVWFSHPRKYGKGSRQCRVCAHQAGLIRKYNLNICRQCFREYSQDIGFIKYR 56 >gb|ORX89665.1| ribosomal protein S14 [Basidiobolus meristosporus CBS 931.73] gb|ORX92303.1| ribosomal protein S14 [Basidiobolus meristosporus CBS 931.73] gb|ORY05984.1| ribosomal protein S14 [Basidiobolus meristosporus CBS 931.73] Length = 56 Score = 108 bits (270), Expect = 4e-25 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAH+ VWFSRPR +GKGSRECRVC HRAGLIRKY LNVCRQCFR+Y+ DIGF KYR Sbjct: 1 MAHEAVWFSRPRNFGKGSRECRVCTHRAGLIRKYGLNVCRQCFRQYASDIGFAKYR 56 >gb|ODQ71702.1| hypothetical protein LIPSTDRAFT_73432 [Lipomyces starkeyi NRRL Y-11557] Length = 56 Score = 107 bits (268), Expect = 8e-25 Identities = 44/56 (78%), Positives = 52/56 (92%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAH+ VW+S PR+YGKG+R+CRVCAH+AGLIRKY LN+CRQCFREYSKDIGF+K R Sbjct: 1 MAHEDVWYSHPRKYGKGARQCRVCAHQAGLIRKYGLNICRQCFREYSKDIGFVKNR 56 >emb|CCX29580.1| Similar to 40S ribosomal protein S29; acc. no. Q9C2P2 [Pyronema omphalodes CBS 100304] Length = 56 Score = 107 bits (267), Expect = 1e-24 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAH+ VW+SRPR YGKGSR+CRVCAH+AGLIRKY LNVCRQCFRE S DIGF+KYR Sbjct: 1 MAHETVWYSRPRTYGKGSRQCRVCAHQAGLIRKYGLNVCRQCFREKSADIGFVKYR 56 >gb|EWC48588.1| 40S ribosomal protein S29 [Drechslerella stenobrocha 248] Length = 56 Score = 107 bits (266), Expect = 1e-24 Identities = 47/56 (83%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAHDQVW+SRPR YGKGSR CRVCAH+AGLIRKY LN+CRQCFRE SKDIGF K R Sbjct: 1 MAHDQVWYSRPRTYGKGSRACRVCAHQAGLIRKYGLNICRQCFRERSKDIGFTKNR 56 >gb|ORZ25871.1| 40S ribosomal protein S29 [Absidia repens] Length = 56 Score = 106 bits (265), Expect = 2e-24 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAH VW SRP+ YGKGSR+CRVCAHRAGLIRKYNLN+CRQCFREY+ DIGF KYR Sbjct: 1 MAHANVWNSRPKSYGKGSRQCRVCAHRAGLIRKYNLNICRQCFREYANDIGFHKYR 56 >gb|KXN65685.1| ribosomal protein S14 [Conidiobolus coronatus NRRL 28638] Length = 56 Score = 106 bits (265), Expect = 2e-24 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 M+HD +WFS PRRYGKGSRECRVC HRAGLIRKY L++CRQCFREY+KDIGF K R Sbjct: 1 MSHDAIWFSHPRRYGKGSRECRVCTHRAGLIRKYGLDLCRQCFREYAKDIGFTKTR 56 >gb|EPS33243.1| hypothetical protein PDE_08205 [Penicillium oxalicum 114-2] Length = 56 Score = 106 bits (265), Expect = 2e-24 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 M H+ VW+SRPR+YGKGSRECRVCAHRAGLIRKY +N+CRQCFRE S DIGF KYR Sbjct: 1 MTHESVWYSRPRKYGKGSRECRVCAHRAGLIRKYGMNICRQCFREKSTDIGFNKYR 56 >gb|EJT97456.1| ribosomal protein S14 [Dacryopinax primogenitus] gb|KZO92550.1| ribosomal protein S14 [Calocera viscosa TUFC12733] Length = 56 Score = 106 bits (265), Expect = 2e-24 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 M HD VWFSRPR+YGKGSR+CRVCAH+AGLIRKY L++CRQCFRE SKDIGF+K R Sbjct: 1 MTHDSVWFSRPRKYGKGSRQCRVCAHQAGLIRKYGLDICRQCFREKSKDIGFVKNR 56 >gb|ORY03439.1| ribosomal protein S14 [Basidiobolus meristosporus CBS 931.73] gb|ORY05873.1| ribosomal protein S14 [Basidiobolus meristosporus CBS 931.73] Length = 56 Score = 106 bits (264), Expect = 3e-24 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAH+ VW SRPR+YGKGSR+CRVC HRAGLIRKY LNVCRQCFR+Y+ DIGF KYR Sbjct: 1 MAHENVWNSRPRQYGKGSRQCRVCTHRAGLIRKYGLNVCRQCFRQYASDIGFAKYR 56 >gb|KZT53861.1| ribosomal protein S14 [Calocera cornea HHB12733] Length = 56 Score = 106 bits (264), Expect = 3e-24 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 M HD VWFSRPR+YGKGSR+CRVCAH+AGLIRKY L +CRQCFRE SKDIGF+K R Sbjct: 1 MTHDSVWFSRPRKYGKGSRQCRVCAHQAGLIRKYGLEICRQCFREKSKDIGFVKNR 56 >emb|CDM37799.1| 40S ribosomal protein S29 [Penicillium roqueforti FM164] emb|CRL21301.1| Ribosomal protein S14 [Penicillium camemberti] gb|OQD60922.1| hypothetical protein PENPOL_c019G10578 [Penicillium polonicum] gb|OQE13346.1| hypothetical protein PENFLA_c049G05716 [Penicillium flavigenum] Length = 56 Score = 106 bits (264), Expect = 3e-24 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 M H+ VW+SRPR+YGKGSRECRVC+HRAGLIRKY +N+CRQCFRE S DIGF KYR Sbjct: 1 MTHESVWYSRPRKYGKGSRECRVCSHRAGLIRKYGMNICRQCFREKSTDIGFTKYR 56 >ref|XP_002148243.1| 40S ribosomal protein S29 [Talaromyces marneffei ATCC 18224] gb|EEA24732.1| 40S ribosomal protein S29, putative [Talaromyces marneffei ATCC 18224] Length = 56 Score = 106 bits (264), Expect = 3e-24 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAH+ VW+SRPR YGKGSRECRVCAH+AGLIRKY L VCRQCFRE S DIGF+KYR Sbjct: 1 MAHENVWYSRPRTYGKGSRECRVCAHKAGLIRKYGLLVCRQCFREKSSDIGFVKYR 56 >gb|OCK93126.1| hypothetical protein K441DRAFT_567174 [Cenococcum geophilum 1.58] Length = 73 Score = 106 bits (265), Expect = 3e-24 Identities = 45/72 (62%), Positives = 57/72 (79%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR*TNL 1392 M+H+ VW+SRPR YGKGSR+CRVC H+AGLIRKY LN+CRQCFRE S DIGF+K R + Sbjct: 1 MSHESVWYSRPRTYGKGSRQCRVCTHKAGLIRKYGLNICRQCFREKSADIGFVKVRLAHT 60 Query: 1393 EKSFFFIFHHLI 1428 +SF ++ L+ Sbjct: 61 YRSFVYLLGALL 72 >ref|XP_002564200.1| Pc22g01560 [Penicillium rubens Wisconsin 54-1255] emb|CAP97444.1| Pc22g01560 [Penicillium rubens Wisconsin 54-1255] gb|KZN86125.1| 40S ribosomal protein [Penicillium chrysogenum] Length = 56 Score = 105 bits (263), Expect = 4e-24 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 M H+ VW+SRPR+YGKGSRECRVC+HRAGLIRKY +N+CRQCFRE S DIGF KYR Sbjct: 1 MTHESVWYSRPRKYGKGSRECRVCSHRAGLIRKYGMNICRQCFREKSTDIGFSKYR 56 >gb|ORZ18851.1| ribosomal protein S14p/S29e-domain-containing protein [Absidia repens] Length = 86 Score = 106 bits (265), Expect = 4e-24 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 5/73 (6%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR*TNL 1392 MAH VW SRP+ YGKG+R+CRVCAHRAGLIRKYNLN+CRQCFREY+ DIGF K + ++ Sbjct: 1 MAHANVWNSRPKSYGKGARQCRVCAHRAGLIRKYNLNICRQCFREYANDIGFHKVKFIDI 60 Query: 1393 EK-----SFFFIF 1416 K SFFF F Sbjct: 61 TKEQRRPSFFFFF 73 >gb|ORZ11472.1| 40S ribosomal protein S29 [Absidia repens] gb|ORZ23415.1| 40S ribosomal protein S29 [Absidia repens] Length = 56 Score = 105 bits (262), Expect = 5e-24 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 MAH VW SRP+ YGKG+R+CRVCAHRAGLIRKYNLN+CRQCFREY+ DIGF KYR Sbjct: 1 MAHANVWNSRPKSYGKGARQCRVCAHRAGLIRKYNLNICRQCFREYANDIGFHKYR 56 >ref|XP_022491167.1| hypothetical protein PENARI_c004G05912 [Penicillium arizonense] gb|OGE55738.1| hypothetical protein PENARI_c004G05912 [Penicillium arizonense] gb|OQD74463.1| hypothetical protein PENDEC_c010G06538 [Penicillium decumbens] Length = 56 Score = 105 bits (262), Expect = 5e-24 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 1213 MAHDQVWFSRPRRYGKGSRECRVCAHRAGLIRKYNLNVCRQCFREYSKDIGFIKYR 1380 M H+ VW+SRPR+YGKGSRECRVC+HRAGLIRKY +N+CRQCFRE S DIGF KYR Sbjct: 1 MTHESVWYSRPRKYGKGSRECRVCSHRAGLIRKYGMNICRQCFREKSTDIGFNKYR 56