BLASTX nr result
ID: Ophiopogon26_contig00037843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00037843 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX79437.1| hypothetical protein RirG_005620 [Rhizophagus irr... 71 1e-11 gb|EXX76888.1| hypothetical protein RirG_028870 [Rhizophagus irr... 71 2e-11 gb|PKY44990.1| hypothetical protein RhiirA4_400549 [Rhizophagus ... 71 3e-11 gb|PKC01520.1| hypothetical protein RhiirA5_402792 [Rhizophagus ... 71 3e-11 dbj|GBC43043.1| hypothetical protein RIR_2613200 [Rhizophagus ir... 71 3e-11 >gb|EXX79437.1| hypothetical protein RirG_005620 [Rhizophagus irregularis DAOM 197198w] Length = 283 Score = 70.9 bits (172), Expect = 1e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 467 NPLTSYNFKEFKEFIKEWSIEKRKKIIRFDDFG 369 NPLTSYNFKEFKEFI+EWSIEKRKKIIRFDD+G Sbjct: 243 NPLTSYNFKEFKEFIREWSIEKRKKIIRFDDYG 275 >gb|EXX76888.1| hypothetical protein RirG_028870 [Rhizophagus irregularis DAOM 197198w] Length = 343 Score = 70.9 bits (172), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 467 NPLTSYNFKEFKEFIKEWSIEKRKKIIRFDDFG 369 NPLTSYNFKEFKEFI+EWSIEKRKKIIRFDD+G Sbjct: 303 NPLTSYNFKEFKEFIREWSIEKRKKIIRFDDYG 335 >gb|PKY44990.1| hypothetical protein RhiirA4_400549 [Rhizophagus irregularis] Length = 486 Score = 70.9 bits (172), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 467 NPLTSYNFKEFKEFIKEWSIEKRKKIIRFDDFG 369 NPLTSYNFKEFKEFI+EWSIEKRKKIIRFDD+G Sbjct: 446 NPLTSYNFKEFKEFIREWSIEKRKKIIRFDDYG 478 >gb|PKC01520.1| hypothetical protein RhiirA5_402792 [Rhizophagus irregularis] Length = 486 Score = 70.9 bits (172), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 467 NPLTSYNFKEFKEFIKEWSIEKRKKIIRFDDFG 369 NPLTSYNFKEFKEFI+EWSIEKRKKIIRFDD+G Sbjct: 446 NPLTSYNFKEFKEFIREWSIEKRKKIIRFDDYG 478 >dbj|GBC43043.1| hypothetical protein RIR_2613200 [Rhizophagus irregularis DAOM 181602] gb|PKC63030.1| hypothetical protein RhiirA1_443600 [Rhizophagus irregularis] gb|PKK66446.1| hypothetical protein RhiirC2_852871 [Rhizophagus irregularis] gb|PKY19117.1| hypothetical protein RhiirB3_468979 [Rhizophagus irregularis] gb|POG64939.1| hypothetical protein GLOIN_2v1880949 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 486 Score = 70.9 bits (172), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 467 NPLTSYNFKEFKEFIKEWSIEKRKKIIRFDDFG 369 NPLTSYNFKEFKEFI+EWSIEKRKKIIRFDD+G Sbjct: 446 NPLTSYNFKEFKEFIREWSIEKRKKIIRFDDYG 478