BLASTX nr result
ID: Ophiopogon26_contig00037728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00037728 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK66030.1| hypothetical protein RhiirC2_754160 [Rhizophagus ... 86 7e-19 gb|PKK55340.1| hypothetical protein RhiirC2_859061, partial [Rhi... 65 2e-10 gb|PKK51120.1| hypothetical protein RhiirC2_803318, partial [Rhi... 65 6e-10 gb|PKK56269.1| hypothetical protein RhiirC2_829671, partial [Rhi... 65 7e-10 gb|PKK56280.1| hypothetical protein RhiirC2_829651, partial [Rhi... 65 7e-10 >gb|PKK66030.1| hypothetical protein RhiirC2_754160 [Rhizophagus irregularis] Length = 123 Score = 86.3 bits (212), Expect = 7e-19 Identities = 45/54 (83%), Positives = 46/54 (85%), Gaps = 6/54 (11%) Frame = -3 Query: 396 HMITTRSAIHK------SAPVLGKHEITTKKFQPTKLTKLTKFSDIASNPLTVT 253 HMI TRSAIHK SAPVLGKHEITTKKFQPTKLTKLT+FSDIASNPL VT Sbjct: 18 HMIATRSAIHKKIQEQQSAPVLGKHEITTKKFQPTKLTKLTRFSDIASNPLIVT 71 >gb|PKK55340.1| hypothetical protein RhiirC2_859061, partial [Rhizophagus irregularis] Length = 155 Score = 65.1 bits (157), Expect = 2e-10 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = -3 Query: 369 HKSAPVLGKHEITTKKFQPTKLTKLTKFSDIASNPLTVT 253 H PVLGKHEITTKKFQPTKLTKL K DI SNPL VT Sbjct: 95 HHPPPVLGKHEITTKKFQPTKLTKLAKLPDIVSNPLCVT 133 >gb|PKK51120.1| hypothetical protein RhiirC2_803318, partial [Rhizophagus irregularis] gb|PKK55538.1| hypothetical protein RhiirC2_802127, partial [Rhizophagus irregularis] Length = 208 Score = 65.1 bits (157), Expect = 6e-10 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = -3 Query: 369 HKSAPVLGKHEITTKKFQPTKLTKLTKFSDIASNPLTVT 253 H PVLGKHEITTKKFQPTKLTKL K DI SNPL VT Sbjct: 148 HHPPPVLGKHEITTKKFQPTKLTKLAKLPDIVSNPLCVT 186 >gb|PKK56269.1| hypothetical protein RhiirC2_829671, partial [Rhizophagus irregularis] Length = 215 Score = 65.1 bits (157), Expect = 7e-10 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = -3 Query: 369 HKSAPVLGKHEITTKKFQPTKLTKLTKFSDIASNPLTVT 253 H PVLGKHEITTKKFQPTKLTKL K DI SNPL VT Sbjct: 136 HHPPPVLGKHEITTKKFQPTKLTKLAKLPDIVSNPLCVT 174 >gb|PKK56280.1| hypothetical protein RhiirC2_829651, partial [Rhizophagus irregularis] Length = 219 Score = 65.1 bits (157), Expect = 7e-10 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = -3 Query: 369 HKSAPVLGKHEITTKKFQPTKLTKLTKFSDIASNPLTVT 253 H PVLGKHEITTKKFQPTKLTKL K DI SNPL VT Sbjct: 136 HHPPPVLGKHEITTKKFQPTKLTKLAKLPDIVSNPLCVT 174