BLASTX nr result
ID: Ophiopogon26_contig00037726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00037726 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK78363.1| hypothetical protein RhiirC2_690676 [Rhizophagus ... 99 2e-21 gb|PKC13087.1| hypothetical protein RhiirA5_309098 [Rhizophagus ... 99 2e-21 gb|PKY41443.1| hypothetical protein RhiirA4_48598 [Rhizophagus i... 99 2e-21 gb|EXX56781.1| hypothetical protein RirG_213020 [Rhizophagus irr... 99 2e-21 gb|PKC66224.1| hypothetical protein RhiirA1_419567 [Rhizophagus ... 82 1e-15 >gb|PKK78363.1| hypothetical protein RhiirC2_690676 [Rhizophagus irregularis] gb|PKY18667.1| hypothetical protein RhiirB3_366227 [Rhizophagus irregularis] Length = 595 Score = 98.6 bits (244), Expect = 2e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 231 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 380 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE Sbjct: 1 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 50 >gb|PKC13087.1| hypothetical protein RhiirA5_309098 [Rhizophagus irregularis] Length = 595 Score = 98.6 bits (244), Expect = 2e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 231 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 380 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE Sbjct: 1 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 50 >gb|PKY41443.1| hypothetical protein RhiirA4_48598 [Rhizophagus irregularis] Length = 765 Score = 98.6 bits (244), Expect = 2e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 231 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 380 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE Sbjct: 1 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 50 >gb|EXX56781.1| hypothetical protein RirG_213020 [Rhizophagus irregularis DAOM 197198w] dbj|GBC46456.1| guanyl-nucleotide exchange factor sec2 [Rhizophagus irregularis DAOM 181602] gb|POG60433.1| hypothetical protein GLOIN_2v1713082 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 765 Score = 98.6 bits (244), Expect = 2e-21 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 231 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 380 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE Sbjct: 1 MPALDSSLTMNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 50 >gb|PKC66224.1| hypothetical protein RhiirA1_419567 [Rhizophagus irregularis] Length = 756 Score = 82.0 bits (201), Expect = 1e-15 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 258 MNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 380 MNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE Sbjct: 1 MNGQESLQQMNETNFIPLILQAQDLVAKLENRVVELENDLE 41