BLASTX nr result
ID: Ophiopogon26_contig00037525
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00037525 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKF01116.1| hypothetical chloroplast RF15 (chloroplast) [Bact... 115 2e-30 gb|AKF01040.1| hypothetical chloroplast RF15 (chloroplast) [Atta... 114 6e-30 gb|AKF00542.1| hypothetical chloroplast RF15 (chloroplast) [Roys... 109 2e-28 gb|AKJ77609.1| Ycf15 (chloroplast) [Dioscorea nipponica] 106 1e-26 ref|YP_008239213.1| hypothetical chloroplast RF15 (chloroplast) ... 97 8e-23 ref|YP_008239136.1| hypothetical chloroplast RF15 (chloroplast) ... 97 8e-23 ref|NP_043074.1| hypothetical protein ZemaCp073 (chloroplast) [Z... 92 3e-21 ref|YP_009269888.1| hypothetical chloroplast RF15 (chloroplast) ... 91 5e-21 gb|KQJ95764.1| hypothetical protein BRADI_3g18883v3, partial [Br... 89 2e-20 ref|YP_009245295.1| ycf15 (chloroplast) [Eriochrysis cf. cayenne... 89 2e-20 ref|XP_013443676.1| ycf15 protein, putative [Medicago truncatula... 92 3e-20 gb|KQJ86849.1| hypothetical protein BRADI_4g08051v3, partial [Br... 89 4e-20 gb|ACI43242.1| unknown (chloroplast) [Coix lacryma-jobi] >gi|209... 88 7e-20 gb|PNT67434.1| hypothetical protein BRADI_3g27344v3, partial [Br... 87 1e-19 ref|YP_009269692.1| hypothetical chloroplast RF15 (chloroplast) ... 84 8e-19 gb|AVM10538.1| hypothetical chloroplast RF15 (chloroplast) [Crem... 83 4e-18 gb|PRQ15674.1| hypothetical protein RchiOBHm_CPg0501791 (chlorop... 84 4e-18 ref|YP_009048244.1| Ycf15 (chloroplast) [Calanthe triplicata] >g... 83 5e-18 ref|YP_009443190.1| hypothetical chloroplast RF15 (chloroplast) ... 82 1e-17 ref|YP_009270176.1| hypothetical chloroplast RF15 (chloroplast) ... 81 2e-17 >gb|AKF01116.1| hypothetical chloroplast RF15 (chloroplast) [Bactris major] gb|AKF01189.1| hypothetical chloroplast RF15 (chloroplast) [Beccariophoenix madagascariensis] gb|AKF01208.1| hypothetical chloroplast RF15 (chloroplast) [Beccariophoenix madagascariensis] Length = 107 Score = 115 bits (287), Expect = 2e-30 Identities = 58/64 (90%), Positives = 59/64 (92%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PIQIFTTKRYWILFRI +RRRKAGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQ Sbjct: 20 VRPIQIFTTKRYWILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQ 79 Query: 152 SLKR 141 SLKR Sbjct: 80 SLKR 83 >gb|AKF01040.1| hypothetical chloroplast RF15 (chloroplast) [Attalea speciosa] gb|AOX12842.1| hypothetical chloroplast RF15 (chloroplast) [Cocos nucifera] gb|AOX12863.1| hypothetical chloroplast RF15 (chloroplast) [Cocos nucifera] Length = 107 Score = 114 bits (284), Expect = 6e-30 Identities = 57/64 (89%), Positives = 59/64 (92%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PIQIFTTKRYWILFRI +RRR+AGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQ Sbjct: 20 VRPIQIFTTKRYWILFRIGPERRRRAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQ 79 Query: 152 SLKR 141 SLKR Sbjct: 80 SLKR 83 >gb|AKF00542.1| hypothetical chloroplast RF15 (chloroplast) [Roystonea regia] Length = 85 Score = 109 bits (273), Expect = 2e-28 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -2 Query: 323 IQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLK 144 +QIFTTKRYWILFRI +RRRKAGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQSLK Sbjct: 1 MQIFTTKRYWILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQSLK 60 Query: 143 R 141 R Sbjct: 61 R 61 >gb|AKJ77609.1| Ycf15 (chloroplast) [Dioscorea nipponica] Length = 126 Score = 106 bits (264), Expect = 1e-26 Identities = 53/60 (88%), Positives = 55/60 (91%) Frame = -2 Query: 317 IFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRT 138 IFTTKRYWILFRI +RRR+AGMPT VCLFSNSPDPIVPI GTSSAKVTE VSRQSLKRT Sbjct: 20 IFTTKRYWILFRIGPERRREAGMPTDVCLFSNSPDPIVPIFGTSSAKVTEWVSRQSLKRT 79 >ref|YP_008239213.1| hypothetical chloroplast RF15 (chloroplast) [Secale cereale] gb|AGP51110.1| hypothetical chloroplast RF15 (chloroplast) [Secale cereale] Length = 132 Score = 96.7 bits (239), Expect = 8e-23 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PI IF TKRYWILFRI +RRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 105 Query: 152 S 150 S Sbjct: 106 S 106 >ref|YP_008239136.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum] ref|YP_008474343.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops tauschii] ref|YP_008474434.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops speltoides] ref|YP_008963948.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops geniculata] ref|YP_008963869.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops cylindrica] gb|AFH89553.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops tauschii] gb|AFN42416.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops speltoides] gb|AGP50797.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. vulgare] gb|AGP50874.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. spontaneum] gb|AGP50954.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. spontaneum] gb|AGP51034.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum] gb|AGP51189.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum subsp. aegilopoides] gb|AGP51326.1| hypothetical chloroplast RF2 (chloroplast) [Triticum aestivum] gb|AGY92899.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops cylindrica] gb|AGY92978.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops geniculata] Length = 132 Score = 96.7 bits (239), Expect = 8e-23 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PI IF TKRYWILFRI +RRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 105 Query: 152 S 150 S Sbjct: 106 S 106 >ref|NP_043074.1| hypothetical protein ZemaCp073 (chloroplast) [Zea mays] ref|NP_043104.1| hypothetical protein ZemaCp103 (chloroplast) [Zea mays] ref|YP_024326.1| hypothetical protein PS017 [Saccharum hybrid cultivar SP-80-3280] ref|YP_024354.1| hypothetical protein PS069 [Saccharum hybrid cultivar SP-80-3280] ref|YP_054680.1| hypothetical protein SaofCp074 (chloroplast) [Saccharum hybrid cultivar NCo 310] ref|YP_054713.1| hypothetical protein SaofCp107 (chloroplast) [Saccharum hybrid cultivar NCo 310] ref|YP_009192458.1| hypothetical protein MsaCp_p075 (chloroplast) [Miscanthus sacchariflorus] ref|YP_009192495.1| hypothetical protein MsaCp_p112 (chloroplast) [Miscanthus sacchariflorus] ref|YP_009192580.1| hypothetical protein MsiCp_p075 (chloroplast) [Miscanthus sinensis] ref|YP_009192617.1| hypothetical protein MsiCp_p112 (chloroplast) [Miscanthus sinensis] ref|YP_009240086.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] ref|YP_009240105.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] ref|YP_009245464.1| ycf15 (chloroplast) [Chrysopogon serrulatus] ref|YP_009245481.1| ycf15 (chloroplast) [Chrysopogon serrulatus] ref|YP_009271710.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] ref|YP_009271729.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] ref|YP_009332191.1| Ycf15 (chloroplast) [Panicum sumatrense] ref|YP_009332208.1| Ycf15 (chloroplast) [Panicum sumatrense] ref|YP_009389617.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] ref|YP_009389648.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] ref|YP_009421788.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] ref|YP_009421819.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] ref|YP_009421894.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] ref|YP_009421925.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] ref|YP_009422000.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] ref|YP_009422031.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] ref|YP_009422106.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] ref|YP_009422137.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] sp|P46666.1|YCF15_MAIZE PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF 99 sp|Q6ENR3.1|YCF15_SACOF PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF99 sp|Q6L3C4.1|YCF15_SACHY RecName: Full=Putative uncharacterized protein ycf15 emb|CAA60336.1| hypothetical protein (chloroplast) [Zea mays] emb|CAA60365.1| hypothetical protein (chloroplast) [Zea mays] gb|AAT44641.1| hypothetical protein PS017 (chloroplast) [Saccharum hybrid cultivar SP80-3280] gb|AAT44668.1| unknown (chloroplast) [Saccharum hybrid cultivar SP80-3280] dbj|BAD27343.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] dbj|BAD27377.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] gb|AHV90369.1| hypothetical chloroplast RF15 (chloroplast) [Setaria italica] gb|AHV90388.1| hypothetical chloroplast RF15 (chloroplast) [Setaria italica] gb|ALP29685.1| hypothetical protein MsaCp_p075 (chloroplast) [Miscanthus sacchariflorus] gb|ALP29722.1| hypothetical protein MsaCp_p112 (chloroplast) [Miscanthus sacchariflorus] gb|ALP29807.1| hypothetical protein MsiCp_p075 (chloroplast) [Miscanthus sinensis] gb|ALP29844.1| hypothetical protein MsiCp_p112 (chloroplast) [Miscanthus sinensis] gb|AMN87236.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] gb|AMN87255.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] gb|AMR98047.1| ycf15 (chloroplast) [Chrysopogon serrulatus] gb|AMR98064.1| ycf15 (chloroplast) [Chrysopogon serrulatus] dbj|BAV38295.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] dbj|BAV38315.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] dbj|BAV38382.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis] dbj|BAV38400.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis] gb|AOD27724.1| putative uncharacterized protein ycf15 (chloroplast) [Saccharum hybrid cultivar RB867515] gb|AOD27744.1| putative uncharacterized protein ycf15 (chloroplast) [Saccharum hybrid cultivar RB867515] gb|APH82158.1| Ycf15 (chloroplast) [Panicum sumatrense] gb|APH82175.1| Ycf15 (chloroplast) [Panicum sumatrense] gb|ARS74330.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74349.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74416.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74435.1| ycf15 (chloroplast) [Chrysopogon zizanioides] emb|CRK62358.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CRK62390.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CRK62586.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] emb|CRK62618.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] emb|CRK62477.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CRK62509.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CRY90712.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] emb|CRY90744.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] emb|CRY89078.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] emb|CRY89110.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] emb|CRY89187.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89219.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89296.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89328.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89405.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89437.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89514.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. condensatus] emb|CRY89546.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. condensatus] emb|CRY89623.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89655.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89732.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89764.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89841.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89873.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89950.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis var. purpurascens] emb|CRY89982.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis var. purpurascens] emb|CRY90059.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90091.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90168.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90200.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90277.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90309.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90385.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90417.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90494.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] emb|CRY90526.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] emb|CRY90603.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] emb|CRY90635.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] gb|ASV52297.1| hypothetical protein (chloroplast) [Saccharum officinarum] gb|ASV52330.1| hypothetical protein (chloroplast) [Saccharum officinarum] emb|CUS18930.1| hypothetical chloroplast RF15 (plastid) [Miscanthus sinensis subsp. sinensis] emb|CUS18963.1| hypothetical chloroplast RF15 (plastid) [Miscanthus sinensis subsp. sinensis] emb|CUS19196.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CUS19229.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CUS19089.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CUS19122.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] Length = 99 Score = 91.7 bits (226), Expect = 3e-21 Identities = 46/61 (75%), Positives = 50/61 (81%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PI IF TKR WILFRI +RRR+A MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 76 Query: 152 S 150 S Sbjct: 77 S 77 >ref|YP_009269888.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] ref|YP_009269905.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] gb|ANT72796.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] gb|ANT72814.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] Length = 80 Score = 90.5 bits (223), Expect = 5e-21 Identities = 48/60 (80%), Positives = 51/60 (85%) Frame = -2 Query: 314 FTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRTM 135 ++ R ILFRI +RRRKAGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSLKRTM Sbjct: 21 YSRPRGTILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSLKRTM 80 >gb|KQJ95764.1| hypothetical protein BRADI_3g18883v3, partial [Brachypodium distachyon] Length = 96 Score = 89.4 bits (220), Expect = 2e-20 Identities = 45/61 (73%), Positives = 49/61 (80%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PI IF TKRYWILFRI +RRRKA MPT + LFSNSP+PIVP+ GTS AKVTE VS Q Sbjct: 14 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLYLFSNSPEPIVPVFGTSGAKVTEWVSHQ 73 Query: 152 S 150 S Sbjct: 74 S 74 >ref|YP_009245295.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] ref|YP_009245312.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] ref|YP_009245380.1| ycf15 (chloroplast) [Eriochrysis laxa] ref|YP_009245397.1| ycf15 (chloroplast) [Eriochrysis laxa] gb|AMR97708.1| ycf15 (chloroplast) [Eriochrysis villosa] gb|AMR97725.1| ycf15 (chloroplast) [Eriochrysis villosa] gb|AMR97793.1| ycf15 (chloroplast) [Eriochrysis cayennensis] gb|AMR97810.1| ycf15 (chloroplast) [Eriochrysis cayennensis] gb|AMR97878.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] gb|AMR97895.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] gb|AMR97963.1| ycf15 (chloroplast) [Eriochrysis laxa] gb|AMR97980.1| ycf15 (chloroplast) [Eriochrysis laxa] Length = 99 Score = 89.4 bits (220), Expect = 2e-20 Identities = 45/61 (73%), Positives = 49/61 (80%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PI IF TKR WILFRI +RRR+A MP +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPMDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 76 Query: 152 S 150 S Sbjct: 77 S 77 >ref|XP_013443676.1| ycf15 protein, putative [Medicago truncatula] gb|KEH17701.1| ycf15 protein, putative [Medicago truncatula] Length = 194 Score = 91.7 bits (226), Expect = 3e-20 Identities = 44/55 (80%), Positives = 47/55 (85%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE 168 V PI IF TKRYWILFRI +RRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTE 100 >gb|KQJ86849.1| hypothetical protein BRADI_4g08051v3, partial [Brachypodium distachyon] Length = 96 Score = 88.6 bits (218), Expect = 4e-20 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PI IF TKRYWILFRI +RRRKA MPT + LFSNSP+PIVP+ GTSSA+VTE +S Q Sbjct: 14 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLSLFSNSPEPIVPVFGTSSAEVTESLSHQ 73 Query: 152 S 150 S Sbjct: 74 S 74 >gb|ACI43242.1| unknown (chloroplast) [Coix lacryma-jobi] gb|ACI43256.1| unknown (chloroplast) [Coix lacryma-jobi] Length = 99 Score = 88.2 bits (217), Expect = 7e-20 Identities = 45/61 (73%), Positives = 49/61 (80%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PI IF TKR WILFRI +RRR+A MPT +CLFSNSPD IVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPTDLCLFSNSPDRIVPVFGTSSAKVTEWVSHQ 76 Query: 152 S 150 S Sbjct: 77 S 77 >gb|PNT67434.1| hypothetical protein BRADI_3g27344v3, partial [Brachypodium distachyon] gb|PNT75429.1| hypothetical protein BRADI_1g32457v3, partial [Brachypodium distachyon] gb|PNT75857.1| hypothetical protein BRADI_1g05793v3, partial [Brachypodium distachyon] Length = 75 Score = 86.7 bits (213), Expect = 1e-19 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -2 Query: 308 TKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQS 150 TKRYWILFRI +RRRKA MPT +CLFSNSP+PIVP+ GTSSAKVTE VS QS Sbjct: 1 TKRYWILFRIGPERRRKAEMPTDLCLFSNSPEPIVPVFGTSSAKVTEWVSHQS 53 >ref|YP_009269692.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] ref|YP_009269707.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] gb|ANT72602.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] gb|ANT72617.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] Length = 61 Score = 84.3 bits (207), Expect = 8e-19 Identities = 44/50 (88%), Positives = 45/50 (90%) Frame = -2 Query: 284 RICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRTM 135 RI +RRRKAGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSLKRTM Sbjct: 12 RIGPERRRKAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSLKRTM 61 >gb|AVM10538.1| hypothetical chloroplast RF15 (chloroplast) [Cremastra appendiculata] Length = 80 Score = 83.2 bits (204), Expect = 4e-18 Identities = 47/62 (75%), Positives = 50/62 (80%) Frame = -2 Query: 332 VHPIQIFTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 153 V PIQ + R ILFRI +RRRKAGMPT VCLFSNSPDP+VPIL TSSAKVTE VSRQ Sbjct: 20 VRPIQ--SRPRGTILFRIGPERRRKAGMPTDVCLFSNSPDPMVPILRTSSAKVTEWVSRQ 77 Query: 152 SL 147 SL Sbjct: 78 SL 79 >gb|PRQ15674.1| hypothetical protein RchiOBHm_CPg0501791 (chloroplast) [Rosa chinensis] Length = 97 Score = 83.6 bits (205), Expect = 4e-18 Identities = 45/68 (66%), Positives = 50/68 (73%) Frame = -2 Query: 440 RWIFSI*RSPIWIIHIPVDRA*F*LFCSEAKISM*AVHPIQIFTTKRYWILFRICRKRRR 261 R IFSI R PIWIIHIPVDR + +K AV PIQIFTTK+YWILFR+ +RRR Sbjct: 29 RRIFSIERPPIWIIHIPVDRL-IQIVLFRSKDIRGAVRPIQIFTTKKYWILFRVGPERRR 87 Query: 260 KAGMPTGV 237 KAGMPTGV Sbjct: 88 KAGMPTGV 95 >ref|YP_009048244.1| Ycf15 (chloroplast) [Calanthe triplicata] ref|YP_009048261.1| Ycf15 (chloroplast) [Calanthe triplicata] gb|AHF71882.1| Ycf15 (chloroplast) [Calanthe triplicata] gb|AHF71883.1| Ycf15 (chloroplast) [Calanthe triplicata] gb|ANZ02142.1| hypothetical chloroplast RF15 (chloroplast) [Dendrobium nobile] gb|ANZ02153.1| hypothetical chloroplast RF15 (chloroplast) [Dendrobium nobile] gb|AVM10456.1| Ycf15 (chloroplast) [Calanthe davidii] gb|AVM10479.1| Ycf15 (chloroplast) [Calanthe davidii] Length = 77 Score = 82.8 bits (203), Expect = 5e-18 Identities = 44/56 (78%), Positives = 47/56 (83%) Frame = -2 Query: 314 FTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSL 147 ++ R ILFRI +RRRKAGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSL Sbjct: 21 YSRPRGTILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSL 76 >ref|YP_009443190.1| hypothetical chloroplast RF15 (chloroplast) [Pleione bulbocodioides] ref|YP_009443208.1| hypothetical chloroplast RF15 (chloroplast) [Pleione bulbocodioides] gb|ATP74855.1| hypothetical chloroplast RF15 (chloroplast) [Pleione bulbocodioides] gb|ATP74856.1| hypothetical chloroplast RF15 (chloroplast) [Pleione bulbocodioides] Length = 77 Score = 81.6 bits (200), Expect = 1e-17 Identities = 43/56 (76%), Positives = 47/56 (83%) Frame = -2 Query: 314 FTTKRYWILFRICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSL 147 ++ R ILFRI +RRR+AGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSL Sbjct: 21 YSRPRGTILFRIGPERRRRAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSL 76 >ref|YP_009270176.1| hypothetical chloroplast RF15 (chloroplast) [Neottia ovata] ref|YP_009270193.1| hypothetical chloroplast RF15 (chloroplast) [Neottia ovata] gb|ANT73082.1| hypothetical chloroplast RF15 (chloroplast) [Neottia ovata] gb|ANT73101.1| hypothetical chloroplast RF15 (chloroplast) [Neottia ovata] Length = 61 Score = 80.9 bits (198), Expect = 2e-17 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = -2 Query: 284 RICRKRRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRTM 135 R+ +RRRKAGMPT VCLF NSPDPIVPIL TSSAKVTE VSRQSLKRTM Sbjct: 12 RMGPERRRKAGMPTDVCLFYNSPDPIVPILRTSSAKVTEWVSRQSLKRTM 61