BLASTX nr result
ID: Ophiopogon26_contig00037466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00037466 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020243749.1| pentatricopeptide repeat-containing protein ... 65 2e-09 >ref|XP_020243749.1| pentatricopeptide repeat-containing protein At1g80270, mitochondrial-like isoform X1 [Asparagus officinalis] gb|ONK61492.1| uncharacterized protein A4U43_C08F30470 [Asparagus officinalis] Length = 635 Score = 65.1 bits (157), Expect = 2e-09 Identities = 36/104 (34%), Positives = 51/104 (49%) Frame = +2 Query: 92 LRGAIKSTRKHCPHVLISQSCSGPSHIVSKNSKHADGNYRRDQHVIGGYAXXXXXXXXXX 271 LR K TR H VLIS+ SH +S +A+GNY R Q++ GY Sbjct: 4 LRQTAKFTRNHNAKVLISRFSPASSHKPCNSSNYAEGNYARYQNITRGYVFFLYKSSSSS 63 Query: 272 XXXVGRRSLCLLAGEKPGNGEHKGEIADQEPQRSDSSGIDMDNE 403 +G RSLC G EH G +Q+ + SD++GI++ N+ Sbjct: 64 RPFLGCRSLCFNMGNTTNKSEHNGTFPNQDSRGSDNTGINVVND 107