BLASTX nr result
ID: Ophiopogon26_contig00037245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00037245 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX75308.1| hypothetical protein RirG_042900 [Rhizophagus irr... 117 7e-31 dbj|GBC24159.1| rRNA-processing protein CGR1 [Rhizophagus irregu... 117 8e-31 gb|OAD01301.1| hypothetical protein MUCCIDRAFT_112739 [Mucor cir... 56 6e-07 gb|EPB89801.1| hypothetical protein HMPREF1544_03322 [Mucor circ... 56 6e-07 gb|ORE09874.1| hypothetical protein BCV72DRAFT_200688 [Rhizopus ... 52 9e-06 gb|ORE18205.1| hypothetical protein BCV71DRAFT_180061 [Rhizopus ... 52 9e-06 >gb|EXX75308.1| hypothetical protein RirG_042900 [Rhizophagus irregularis DAOM 197198w] Length = 124 Score = 117 bits (293), Expect = 7e-31 Identities = 57/61 (93%), Positives = 58/61 (95%) Frame = +2 Query: 2 LDKHSDPILNTELSASTNIKKLSITRRVSGKTWKHPKTATRRSQLPRSLRKNWDEKLKER 181 LDKHSDP NTE SASTNIKKLSITRRVSGKTWKHPKTATRRSQLPRSLRKNW+EKLKER Sbjct: 3 LDKHSDPTPNTEPSASTNIKKLSITRRVSGKTWKHPKTATRRSQLPRSLRKNWNEKLKER 62 Query: 182 N 184 N Sbjct: 63 N 63 >dbj|GBC24159.1| rRNA-processing protein CGR1 [Rhizophagus irregularis DAOM 181602] gb|PKC16609.1| hypothetical protein RhiirA5_472165 [Rhizophagus irregularis] gb|PKC69569.1| hypothetical protein RhiirA1_504135 [Rhizophagus irregularis] gb|PKK74812.1| hypothetical protein RhiirC2_274859 [Rhizophagus irregularis] gb|PKY20305.1| hypothetical protein RhiirB3_384774 [Rhizophagus irregularis] gb|POG82551.1| Cgr1 family-domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 127 Score = 117 bits (293), Expect = 8e-31 Identities = 57/61 (93%), Positives = 58/61 (95%) Frame = +2 Query: 2 LDKHSDPILNTELSASTNIKKLSITRRVSGKTWKHPKTATRRSQLPRSLRKNWDEKLKER 181 LDKHSDP NTE SASTNIKKLSITRRVSGKTWKHPKTATRRSQLPRSLRKNW+EKLKER Sbjct: 3 LDKHSDPTPNTEPSASTNIKKLSITRRVSGKTWKHPKTATRRSQLPRSLRKNWNEKLKER 62 Query: 182 N 184 N Sbjct: 63 N 63 >gb|OAD01301.1| hypothetical protein MUCCIDRAFT_112739 [Mucor circinelloides f. lusitanicus CBS 277.49] Length = 123 Score = 55.8 bits (133), Expect = 6e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 68 SITRRVSGKTWKHPKTATRRSQLPRSLRKNWDEKLKER 181 +I +RVSGK WK KTAT R+Q P+ LRKNWD++ KER Sbjct: 19 TINKRVSGKNWKIQKTATARNQQPKQLRKNWDQRSKER 56 >gb|EPB89801.1| hypothetical protein HMPREF1544_03322 [Mucor circinelloides f. circinelloides 1006PhL] dbj|GAN05498.1| conserved hypothetical protein [Mucor ambiguus] Length = 123 Score = 55.8 bits (133), Expect = 6e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 68 SITRRVSGKTWKHPKTATRRSQLPRSLRKNWDEKLKER 181 +I +RVSGK WK KTAT R+Q P+ LRKNWD++ KER Sbjct: 19 TINKRVSGKNWKIQKTATARNQQPKQLRKNWDQRSKER 56 >gb|ORE09874.1| hypothetical protein BCV72DRAFT_200688 [Rhizopus microsporus var. microsporus] Length = 81 Score = 51.6 bits (122), Expect = 9e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 68 SITRRVSGKTWKHPKTATRRSQLPRSLRKNWDEKLKER 181 ++ +RVSGK WK K AT R+Q P+ LRK+WDE+ KER Sbjct: 19 TVNKRVSGKIWKVQKKATVRNQQPKQLRKSWDERTKER 56 >gb|ORE18205.1| hypothetical protein BCV71DRAFT_180061 [Rhizopus microsporus] Length = 82 Score = 51.6 bits (122), Expect = 9e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = +2 Query: 68 SITRRVSGKTWKHPKTATRRSQLPRSLRKNWDEKLKER 181 ++ +RVSGK WK K AT R+Q P+ LRK+WDE+ KER Sbjct: 19 TVNKRVSGKIWKVQKKATVRNQQPKQLRKSWDERTKER 56