BLASTX nr result
ID: Ophiopogon26_contig00036736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036736 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA64799.1| hypothetical protein AXF42_Ash016830 [Apostasia s... 57 3e-07 >gb|PKA64799.1| hypothetical protein AXF42_Ash016830 [Apostasia shenzhenica] Length = 183 Score = 56.6 bits (135), Expect = 3e-07 Identities = 32/81 (39%), Positives = 47/81 (58%) Frame = +3 Query: 75 D*HKRIQESAGGDRVMIWVCSERFLPRIVENRLARCTCSYIVLREIDSVAYRLEIPRALS 254 D HK++QE + GD VMIWV ERF R V+ AR + + ++I S AY +++P+ Sbjct: 61 DCHKKMQEFSEGDYVMIWVRPERFPSRTVKKLQARGAGPFRIFKKIGSNAYVVDLPQEYG 120 Query: 255 ISLVFDGEDLLQYYMLCRVSS 317 IS F+ DL+ Y L + S Sbjct: 121 ISSTFNISDLVAYKELTVIPS 141