BLASTX nr result
ID: Ophiopogon26_contig00036602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036602 (777 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019703150.1| PREDICTED: meiotic recombination protein SPO... 56 5e-06 >ref|XP_019703150.1| PREDICTED: meiotic recombination protein SPO11-1-like, partial [Elaeis guineensis] Length = 176 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +2 Query: 110 VAGFVQSLMSDLAINRLPSVALERYRNYCSNPCGNC 217 + GFV+SL+ D++INR PSVAL+R+R YCS+P GNC Sbjct: 17 IKGFVRSLIEDISINRAPSVALDRFRIYCSDPSGNC 52