BLASTX nr result
ID: Ophiopogon26_contig00036548
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036548 (820 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB33946.1| hypothetical protein L484_005845 [Morus notabilis] 75 1e-13 >gb|EXB33946.1| hypothetical protein L484_005845 [Morus notabilis] Length = 112 Score = 75.5 bits (184), Expect = 1e-13 Identities = 48/84 (57%), Positives = 53/84 (63%), Gaps = 2/84 (2%) Frame = +3 Query: 3 TTELLRKNSLKEADSRSLDQPTYDRKEKKFRNFLFFTYTGRKGD--DSNPLCLPGRRASR 176 TTELLR N LKEADSRSLDQP E+K+ F G K S+P P Sbjct: 38 TTELLRNNRLKEADSRSLDQPM---TEQKWVRHSFSHTPGEKVTIASSSPAGEP------ 88 Query: 177 TGQGGGGQPSTLDMHIDQSISASC 248 GQGGGGQPSTL++HIDQSISASC Sbjct: 89 PGQGGGGQPSTLEIHIDQSISASC 112