BLASTX nr result
ID: Ophiopogon26_contig00036344
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036344 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252248.1| uncharacterized protein LOC109829595 [Aspara... 64 5e-09 ref|XP_020272038.1| uncharacterized protein LOC109847206 [Aspara... 60 1e-07 ref|XP_020266271.1| uncharacterized protein LOC109841739 [Aspara... 58 4e-07 >ref|XP_020252248.1| uncharacterized protein LOC109829595 [Asparagus officinalis] Length = 942 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 228 KRGLRQGSPLSPLLFVLAADVFAKMLNLAAQNGVLSGLSPNN 353 KRG+RQG PLSPLLFVLAAD F KMLNLA ++ + GL PNN Sbjct: 450 KRGVRQGDPLSPLLFVLAADSFTKMLNLAVESHFIEGLGPNN 491 >ref|XP_020272038.1| uncharacterized protein LOC109847206 [Asparagus officinalis] Length = 655 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = +3 Query: 228 KRGLRQGSPLSPLLFVLAADVFAKMLNLAAQNGVLSGLSPNN*LHE*F 371 KRG+RQG PLSPLLFVLAAD F +ML+LA + ++ GL P N H+ F Sbjct: 274 KRGVRQGDPLSPLLFVLAADTFTRMLSLAVGSQLIEGLGPINMTHKVF 321 >ref|XP_020266271.1| uncharacterized protein LOC109841739 [Asparagus officinalis] Length = 310 Score = 58.2 bits (139), Expect = 4e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 228 KRGLRQGSPLSPLLFVLAADVFAKMLNLAAQNGVLSGLSPNN 353 KRG+RQG PLSPLLFVLAAD F MLNLAA+ ++ L P N Sbjct: 17 KRGVRQGDPLSPLLFVLAADAFTSMLNLAAEASLIERLGPIN 58