BLASTX nr result
ID: Ophiopogon26_contig00036296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036296 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267860.1| pentatricopeptide repeat-containing protein ... 60 1e-07 >ref|XP_020267860.1| pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Asparagus officinalis] ref|XP_020274224.1| pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like [Asparagus officinalis] gb|ONK64563.1| uncharacterized protein A4U43_C07F27400 [Asparagus officinalis] gb|ONK81912.1| uncharacterized protein A4U43_C01F34200 [Asparagus officinalis] Length = 1107 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/53 (58%), Positives = 34/53 (64%) Frame = +2 Query: 269 MGSNMVELCSSGVLCXXXXXXXXXXXXAVSCDLGTCRRQRGKNLKFFTSGFLV 427 M NMV+LCSSGVLC AVS DLG CRRQ +NLK F+SGFLV Sbjct: 1 MSVNMVDLCSSGVLCSSPVNYRTNGKRAVSFDLGNCRRQGFENLKVFSSGFLV 53