BLASTX nr result
ID: Ophiopogon26_contig00036265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036265 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT31173.1| hypothetical protein POPTR_006G120500v3 [Populus ... 53 3e-06 ref|XP_006381365.1| hypothetical protein POPTR_0006s12210g [Popu... 53 4e-06 >gb|PNT31173.1| hypothetical protein POPTR_006G120500v3 [Populus trichocarpa] Length = 141 Score = 53.1 bits (126), Expect = 3e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 264 KYGMEQSYFKVLKIPKGWDRLVLSIVSVETGKTIAK 371 K + SYFK L++P+GWD+L +SI+SVETGKTIAK Sbjct: 18 KIDFKFSYFKALQVPRGWDKLSVSIISVETGKTIAK 53 >ref|XP_006381365.1| hypothetical protein POPTR_0006s12210g [Populus trichocarpa] gb|PNT31172.1| hypothetical protein POPTR_006G120500v3 [Populus trichocarpa] Length = 147 Score = 53.1 bits (126), Expect = 4e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = +3 Query: 264 KYGMEQSYFKVLKIPKGWDRLVLSIVSVETGKTIAK 371 K + SYFK L++P+GWD+L +SI+SVETGKTIAK Sbjct: 18 KIDFKFSYFKALQVPRGWDKLSVSIISVETGKTIAK 53