BLASTX nr result
ID: Ophiopogon26_contig00036174
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036174 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266105.1| uncharacterized protein LOC109841555 [Aspara... 62 2e-08 ref|XP_020253938.1| uncharacterized protein LOC109831005 [Aspara... 60 1e-07 ref|XP_020241522.1| uncharacterized protein LOC109819937 isoform... 59 3e-07 ref|XP_020241521.1| uncharacterized protein LOC109819937 isoform... 59 3e-07 ref|XP_020241520.1| uncharacterized protein LOC109819937 isoform... 59 3e-07 ref|XP_020272128.1| uncharacterized protein LOC109847304 [Aspara... 59 3e-07 ref|XP_020265674.1| uncharacterized protein LOC109841186 [Aspara... 59 4e-07 ref|XP_020255970.1| uncharacterized protein LOC109832900 [Aspara... 57 8e-07 >ref|XP_020266105.1| uncharacterized protein LOC109841555 [Asparagus officinalis] Length = 564 Score = 62.4 bits (150), Expect = 2e-08 Identities = 31/58 (53%), Positives = 36/58 (62%) Frame = -2 Query: 404 FKQHLAHERGNCAPCANVLDDVKVKAHEALDALKSSRVTKETRLQTERDEVHIDIGEK 231 FKQHLA +RGNCAPC V DDVK K + LD K SR KE ++ EVHI E+ Sbjct: 65 FKQHLAGKRGNCAPCVKVPDDVKAKVSKILDNAKKSRDEKEMKMHNLLSEVHIGEDEE 122 >ref|XP_020253938.1| uncharacterized protein LOC109831005 [Asparagus officinalis] Length = 730 Score = 60.1 bits (144), Expect = 1e-07 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = -2 Query: 407 SFKQHLAHERGNCAPCANVLDDVKVKAHEALDALKSSRVTKETRLQTERDEVHI 246 SFK HLA +RGNC PC V DDVK K E L+ K S+ KET++ EVHI Sbjct: 20 SFKSHLAGKRGNCTPCIKVPDDVKRKVSEILENAKKSKEDKETKIHNLLSEVHI 73 >ref|XP_020241522.1| uncharacterized protein LOC109819937 isoform X3 [Asparagus officinalis] Length = 633 Score = 58.9 bits (141), Expect = 3e-07 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = -2 Query: 404 FKQHLAHERGNCAPCANVLDDVKVKAHEALDALKSSRVTKETRLQTERDEVHIDIGEKTF 225 FKQHLA +GNC PC V +DVK K +E +D+ K ++ KE ++Q D+VH IGE+ Sbjct: 58 FKQHLAGIKGNCLPCEKVPEDVKKKVNEIIDSAKKNKGAKELKMQNLLDDVH--IGEEEG 115 Query: 224 VEQS 213 E S Sbjct: 116 YEGS 119 >ref|XP_020241521.1| uncharacterized protein LOC109819937 isoform X2 [Asparagus officinalis] Length = 662 Score = 58.9 bits (141), Expect = 3e-07 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = -2 Query: 404 FKQHLAHERGNCAPCANVLDDVKVKAHEALDALKSSRVTKETRLQTERDEVHIDIGEKTF 225 FKQHLA +GNC PC V +DVK K +E +D+ K ++ KE ++Q D+VH IGE+ Sbjct: 50 FKQHLAGIKGNCLPCEKVPEDVKKKVNEIIDSAKKNKGAKELKMQNLLDDVH--IGEEEG 107 Query: 224 VEQS 213 E S Sbjct: 108 YEGS 111 >ref|XP_020241520.1| uncharacterized protein LOC109819937 isoform X1 [Asparagus officinalis] Length = 670 Score = 58.9 bits (141), Expect = 3e-07 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = -2 Query: 404 FKQHLAHERGNCAPCANVLDDVKVKAHEALDALKSSRVTKETRLQTERDEVHIDIGEKTF 225 FKQHLA +GNC PC V +DVK K +E +D+ K ++ KE ++Q D+VH IGE+ Sbjct: 58 FKQHLAGIKGNCLPCEKVPEDVKKKVNEIIDSAKKNKGAKELKMQNLLDDVH--IGEEEG 115 Query: 224 VEQS 213 E S Sbjct: 116 YEGS 119 >ref|XP_020272128.1| uncharacterized protein LOC109847304 [Asparagus officinalis] Length = 337 Score = 58.5 bits (140), Expect = 3e-07 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = -2 Query: 404 FKQHLAHERGNCAPCANVLDDVKVKAHEALDALKSSRVTKETRLQTERDEVHIDIGEKTF 225 FKQHLA +GNC PC VL DVK K ++ +D+ K ++ KE ++Q D+VH IGE+ Sbjct: 50 FKQHLAGIKGNCLPCEKVLGDVKKKVNKIIDSAKKNKGAKELKMQDLLDDVH--IGEEEG 107 Query: 224 VEQS 213 E S Sbjct: 108 YEGS 111 >ref|XP_020265674.1| uncharacterized protein LOC109841186 [Asparagus officinalis] Length = 685 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/58 (48%), Positives = 35/58 (60%) Frame = -2 Query: 404 FKQHLAHERGNCAPCANVLDDVKVKAHEALDALKSSRVTKETRLQTERDEVHIDIGEK 231 FK HLA +RGNC PC V DDVK K E ++ K S+ KET++ EVHI E+ Sbjct: 52 FKAHLAEKRGNCTPCIKVPDDVKRKVSEMMENAKKSKEDKETKIHNLLSEVHIGDDEE 109 >ref|XP_020255970.1| uncharacterized protein LOC109832900 [Asparagus officinalis] Length = 408 Score = 57.4 bits (137), Expect = 8e-07 Identities = 28/58 (48%), Positives = 36/58 (62%) Frame = -2 Query: 404 FKQHLAHERGNCAPCANVLDDVKVKAHEALDALKSSRVTKETRLQTERDEVHIDIGEK 231 FKQHLA +RGNCA C V DDVK K + LD +K S+ KE ++ EV+I E+ Sbjct: 66 FKQHLAEKRGNCASCVKVPDDVKAKVSKILDNVKKSKDEKEMKMHNLLSEVYIGEDEE 123