BLASTX nr result
ID: Ophiopogon26_contig00036133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036133 (1437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY38640.1| hypothetical protein RhiirA4_451662 [Rhizophagus ... 134 4e-30 >gb|PKY38640.1| hypothetical protein RhiirA4_451662 [Rhizophagus irregularis] Length = 569 Score = 134 bits (336), Expect = 4e-30 Identities = 77/117 (65%), Positives = 81/117 (69%), Gaps = 6/117 (5%) Frame = +3 Query: 462 SGFVCPLNYEFFKNPCCFDSQFQLRTLPLLKCLTFLTTFEYTI*RQY*LDSSWEE*LVDF 641 SGFVCPLNYEF KNPCCFDSQFQLRTLPLLKCLTFLTT LV F Sbjct: 473 SGFVCPLNYEFLKNPCCFDSQFQLRTLPLLKCLTFLTT----------------SILVGF 516 Query: 642 LY------VSLCKFFAISIAGMVKSGLKSVVLAVDELIELDPGAVLAACKLLFLVRQ 794 + +S+C+F VKSGLKSVVLAVDELIELDPGAVLAACKLLFLV Q Sbjct: 517 IVGGIVGRLSICEF----DCRYVKSGLKSVVLAVDELIELDPGAVLAACKLLFLVHQ 569