BLASTX nr result
ID: Ophiopogon26_contig00036105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00036105 (528 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264225.1| 60S ribosomal protein L30 [Asparagus officin... 53 6e-06 >ref|XP_020264225.1| 60S ribosomal protein L30 [Asparagus officinalis] ref|XP_020242492.1| 60S ribosomal protein L30 [Asparagus officinalis] gb|ONK61672.1| uncharacterized protein A4U43_C08F32380 [Asparagus officinalis] gb|ONK69270.1| uncharacterized protein A4U43_C05F21100 [Asparagus officinalis] Length = 112 Score = 53.1 bits (126), Expect = 6e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 400 IGFVRRLLRSHCLVISVSIGKLIIIANNCPPLRKSLIEYYAML 528 +GF + +LRS + S GKLIIIANNCPPLRKSLIEYYAML Sbjct: 29 LGF-KTVLRS----LRSSKGKLIIIANNCPPLRKSLIEYYAML 66