BLASTX nr result
ID: Ophiopogon26_contig00035889
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00035889 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC61815.1| hypothetical protein RhiirA1_466016 [Rhizophagus ... 63 3e-09 gb|PKY57340.1| hypothetical protein RhiirA4_509705 [Rhizophagus ... 62 1e-08 >gb|PKC61815.1| hypothetical protein RhiirA1_466016 [Rhizophagus irregularis] gb|PKY26991.1| hypothetical protein RhiirB3_442523 [Rhizophagus irregularis] Length = 181 Score = 63.2 bits (152), Expect = 3e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 KTLDEAKRDLEADFPEGLKRFKNPLKKLINALEGW 107 KTLDE K+DLE DFP+ LK FKNPLKKLINALE W Sbjct: 147 KTLDEVKKDLETDFPDDLKEFKNPLKKLINALESW 181 >gb|PKY57340.1| hypothetical protein RhiirA4_509705 [Rhizophagus irregularis] Length = 215 Score = 62.0 bits (149), Expect = 1e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 KTLDEAKRDLEADFPEGLKRFKNPLKKLINALEGW 107 KTLDE K+DLE DFP+ LK FKNPLKKLIN+LE W Sbjct: 181 KTLDEVKKDLETDFPDDLKEFKNPLKKLINSLESW 215