BLASTX nr result
ID: Ophiopogon26_contig00035886
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00035886 (532 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF63482.1| hypothetical protein [Potamogeton distinctus] 56 2e-07 >dbj|BAF63482.1| hypothetical protein [Potamogeton distinctus] Length = 76 Score = 56.2 bits (134), Expect = 2e-07 Identities = 34/75 (45%), Positives = 46/75 (61%), Gaps = 4/75 (5%) Frame = +2 Query: 143 MSSLVDIWTTEFAKLREKGQAIF----LPANPSPKAEENSALCFSILSQKLSTKSRQEAA 310 MS LVD+WT E AKLREK Q F P + ++ S++ + +LSQ L K +Q Sbjct: 1 MSGLVDMWTNEVAKLREKSQEFFKRDSTPPTSHVREKQQSSVRYPVLSQALRIK-KQPPV 59 Query: 311 TLCSEAAVTTMMVEC 355 TLCS AAV +M+V+C Sbjct: 60 TLCSVAAV-SMIVDC 73