BLASTX nr result
ID: Ophiopogon26_contig00035704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00035704 (573 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK61925.1| uncharacterized protein A4U43_C08F34980 [Asparagu... 149 7e-41 ref|XP_020102032.1| pentatricopeptide repeat-containing protein ... 84 1e-15 gb|PKU87927.1| Pentatricopeptide repeat-containing protein [Dend... 80 4e-14 ref|XP_020691344.1| pentatricopeptide repeat-containing protein ... 80 4e-14 ref|XP_020582981.1| pentatricopeptide repeat-containing protein ... 78 3e-13 ref|XP_010909359.1| PREDICTED: pentatricopeptide repeat-containi... 76 9e-13 gb|PKA65612.1| Protein Rf1, mitochondrial [Apostasia shenzhenica] 76 1e-12 ref|XP_008777992.1| PREDICTED: putative pentatricopeptide repeat... 75 3e-12 ref|XP_018684570.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-10 ref|XP_009409010.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-10 ref|XP_010255177.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 gb|ERN14364.1| hypothetical protein AMTR_s00033p00222240 [Ambore... 66 3e-09 ref|XP_006852897.2| putative pentatricopeptide repeat-containing... 66 4e-09 ref|XP_019174103.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 emb|CDY51169.1| BnaCnng20350D [Brassica napus] 56 7e-06 ref|XP_013720094.1| pentatricopeptide repeat-containing protein ... 56 7e-06 pdb|5I9D|A Chain A, Crystal Structure Of Designed Pentatricopept... 56 7e-06 >gb|ONK61925.1| uncharacterized protein A4U43_C08F34980 [Asparagus officinalis] Length = 284 Score = 149 bits (375), Expect = 7e-41 Identities = 76/112 (67%), Positives = 87/112 (77%), Gaps = 5/112 (4%) Frame = +2 Query: 2 ETYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNL 181 ETYS+MI KFLEKGEV+I +S+LDE+ K KAGVDLY IVRGL+KCGRV+E KW+N Sbjct: 173 ETYSVMIGKFLEKGEVDIGVSLLDEMRAKNLKAGVDLYCDIVRGLYKCGRVEEGEKWMNA 232 Query: 182 MIEKGILVSYEGWESLYDSVTME-----GELWKAIEANYNEANESERRRVKR 322 MI GILVSYE WESLYDSV ME GELWK IEAN +A E E+RR+KR Sbjct: 233 MIGNGILVSYESWESLYDSVIMEGDREIGELWKEIEANC-KAREDEKRRLKR 283 >ref|XP_020102032.1| pentatricopeptide repeat-containing protein At1g12775, mitochondrial-like [Ananas comosus] Length = 478 Score = 84.3 bits (207), Expect = 1e-15 Identities = 41/79 (51%), Positives = 54/79 (68%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TY +MI L KG+ +I++LDE+ KK +A V LYS IVR L++ G ++ES K+LN M Sbjct: 396 TYELMIFGLLNKGDTTAAIALLDEMTKKKIRADVRLYSAIVRRLYEDGAIEESNKYLNRM 455 Query: 185 IEKGILVSYEGWESLYDSV 241 IE GIL SY WE L DS+ Sbjct: 456 IENGILASYSAWEGLVDSM 474 >gb|PKU87927.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 562 Score = 80.1 bits (196), Expect = 4e-14 Identities = 38/80 (47%), Positives = 55/80 (68%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TY++MI FL G +E + ++L+E+ +KF A VDLY +VR LH CGR E+ +LN M Sbjct: 462 TYAIMINGFLRVGMIEKATTVLEEMRREKFAASVDLYLVLVRNLHLCGRSKEALGYLNYM 521 Query: 185 IEKGILVSYEGWESLYDSVT 244 IE G+ VSY WE +++S+T Sbjct: 522 IENGVFVSYTQWEVMFESLT 541 >ref|XP_020691344.1| pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Dendrobium catenatum] Length = 562 Score = 80.1 bits (196), Expect = 4e-14 Identities = 38/80 (47%), Positives = 55/80 (68%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TY++MI FL G +E + ++L+E+ +KF A VDLY +VR LH CGR E+ +LN M Sbjct: 462 TYAIMINGFLRVGMIEKATTVLEEMRREKFAASVDLYLVLVRNLHLCGRSKEALGYLNYM 521 Query: 185 IEKGILVSYEGWESLYDSVT 244 IE G+ VSY WE +++S+T Sbjct: 522 IENGVFVSYTQWEVMFESLT 541 >ref|XP_020582981.1| pentatricopeptide repeat-containing protein At3g07290, mitochondrial-like [Phalaenopsis equestris] Length = 559 Score = 77.8 bits (190), Expect = 3e-13 Identities = 37/80 (46%), Positives = 54/80 (67%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TY++MI + G VE + I +E+ +KF A VDLY +VR LH CGR E++++LN M Sbjct: 461 TYAIMIHVLVRMGMVEKATGIFEEMRREKFAASVDLYGVLVRNLHFCGRSKEAQEYLNYM 520 Query: 185 IEKGILVSYEGWESLYDSVT 244 IE G+ VSY WE L++S++ Sbjct: 521 IENGVFVSYAQWEVLFESLS 540 >ref|XP_010909359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like [Elaeis guineensis] Length = 539 Score = 76.3 bits (186), Expect = 9e-13 Identities = 37/84 (44%), Positives = 53/84 (63%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS+MI FL+KG+ +IS+L+++ +K L S + H G+ +E +LN M Sbjct: 449 TYSVMIHGFLKKGDGMTAISLLEDMAREKMPVNFSLCSAVALSFHAQGKFEELNSYLNKM 508 Query: 185 IEKGILVSYEGWESLYDSVTMEGE 256 IE GILVSY WESL++SVT+ E Sbjct: 509 IENGILVSYAAWESLFESVTIRNE 532 >gb|PKA65612.1| Protein Rf1, mitochondrial [Apostasia shenzhenica] Length = 565 Score = 75.9 bits (185), Expect = 1e-12 Identities = 34/73 (46%), Positives = 53/73 (72%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 ++S++I + L + EVE + ++++E+V +KF+AGVDLY +V L CGR +E+ +LN M Sbjct: 480 SFSIVIHQLLSRREVEKARNVVEEMVRRKFQAGVDLYCELVNSLQSCGRFEEANYYLNSM 539 Query: 185 IEKGILVSYEGWE 223 IE G+LVSY WE Sbjct: 540 IESGVLVSYSQWE 552 >ref|XP_008777992.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Phoenix dactylifera] Length = 541 Score = 74.7 bits (182), Expect = 3e-12 Identities = 35/85 (41%), Positives = 54/85 (63%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS+MI FL KG++ +IS+L+++ +K L SG+ +H G ++ +LN M Sbjct: 450 TYSVMIHGFLRKGDIMTAISLLEDMAREKMPVSFSLCSGVALSIHAQGELELLHDYLNKM 509 Query: 185 IEKGILVSYEGWESLYDSVTMEGEL 259 IE GILVSY WE L++S+T+ E+ Sbjct: 510 IENGILVSYAAWELLFESMTIRNEV 534 >ref|XP_018684570.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, mitochondrial-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 536 Score = 70.1 bits (170), Expect = 1e-10 Identities = 30/84 (35%), Positives = 56/84 (66%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS+MI +L +G+ +++S ++++ +K + V L++ +VR L+ G+++E+ ++N M Sbjct: 439 TYSLMIHGYLGRGDTAMAVSFVEQMEREKMQVDVGLHTSVVRSLYTTGKLEETHHYMNKM 498 Query: 185 IEKGILVSYEGWESLYDSVTMEGE 256 IE G +VSY WE +S+TM E Sbjct: 499 IESGTIVSYAEWEEFVNSMTMRIE 522 >ref|XP_009409010.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018684569.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62720-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 580 Score = 70.1 bits (170), Expect = 1e-10 Identities = 30/84 (35%), Positives = 56/84 (66%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS+MI +L +G+ +++S ++++ +K + V L++ +VR L+ G+++E+ ++N M Sbjct: 483 TYSLMIHGYLGRGDTAMAVSFVEQMEREKMQVDVGLHTSVVRSLYTTGKLEETHHYMNKM 542 Query: 185 IEKGILVSYEGWESLYDSVTMEGE 256 IE G +VSY WE +S+TM E Sbjct: 543 IESGTIVSYAEWEEFVNSMTMRIE 566 >ref|XP_010255177.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Nelumbo nucifera] Length = 564 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/84 (40%), Positives = 51/84 (60%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TY + + E+GE+ ++ + DE++ KK +Y I+RGL CGR++E+ +LN M Sbjct: 474 TYVVFVNGLCEQGELTNALLVFDEMLEKKIPVNGTIYEVILRGLCTCGRIEEAHMYLNKM 533 Query: 185 IEKGILVSYEGWESLYDSVTMEGE 256 IE G LVSY W+ L DSV + E Sbjct: 534 IENGHLVSYSRWKVLLDSVFVGNE 557 >gb|ERN14364.1| hypothetical protein AMTR_s00033p00222240 [Amborella trichopoda] Length = 349 Score = 65.9 bits (159), Expect = 3e-09 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 1/85 (1%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS+M+ E G + ++ I E++ K LY I+RGL K G E+ LN M Sbjct: 245 TYSIMVTGLCENGHLSKALCIFQEMINNKVPVNGSLYDIIIRGLCKIGSFQEAHMLLNEM 304 Query: 185 IEKGILVSYEGWESLYDS-VTMEGE 256 IE G L SY GW SL DS + ++GE Sbjct: 305 IENGYLASYLGWSSLVDSMLELDGE 329 >ref|XP_006852897.2| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Amborella trichopoda] Length = 514 Score = 65.9 bits (159), Expect = 4e-09 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 1/85 (1%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS+M+ E G + ++ I E++ K LY I+RGL K G E+ LN M Sbjct: 410 TYSIMVTGLCENGHLSKALCIFQEMINNKVPVNGSLYDIIIRGLCKIGSFQEAHMLLNEM 469 Query: 185 IEKGILVSYEGWESLYDS-VTMEGE 256 IE G L SY GW SL DS + ++GE Sbjct: 470 IENGYLASYLGWSSLVDSMLELDGE 494 >ref|XP_019174103.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial-like [Ipomoea nil] Length = 542 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/75 (37%), Positives = 45/75 (60%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TY MI + +G V ++ +LDE++ +K LY+ I+ GL CGRV+++ ++ N M Sbjct: 454 TYGTMINGYCNEGNVSKAVRLLDEMLSRKMSVNQTLYAMIIGGLCACGRVEQALQYFNAM 513 Query: 185 IEKGILVSYEGWESL 229 +E G VS + ESL Sbjct: 514 VENGHAVSGKRCESL 528 >emb|CDY51169.1| BnaCnng20350D [Brassica napus] Length = 423 Score = 56.2 bits (134), Expect = 7e-06 Identities = 34/95 (35%), Positives = 53/95 (55%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS++I + G +E ++S+ +E+ K KA V Y+ +V G GR D+ + L M Sbjct: 53 TYSIIIDSLCKDGSLEEALSLFNEMETKGIKADVTTYNSLVGGFCNAGRQDDGAQLLRDM 112 Query: 185 IEKGILVSYEGWESLYDSVTMEGELWKAIEANYNE 289 I +GI + + +L DS EG+L +A E YNE Sbjct: 113 ITRGITPNVITFSALIDSFVKEGKLKEAKEL-YNE 146 >ref|XP_013720094.1| pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like, partial [Brassica napus] Length = 427 Score = 56.2 bits (134), Expect = 7e-06 Identities = 34/95 (35%), Positives = 53/95 (55%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS++I + G +E ++S+ +E+ K KA V Y+ +V G GR D+ + L M Sbjct: 57 TYSIIIDSLCKDGSLEEALSLFNEMETKGIKADVTTYNSLVGGFCNAGRQDDGAQLLRDM 116 Query: 185 IEKGILVSYEGWESLYDSVTMEGELWKAIEANYNE 289 I +GI + + +L DS EG+L +A E YNE Sbjct: 117 ITRGITPNVITFSALIDSFVKEGKLKEAKEL-YNE 150 >pdb|5I9D|A Chain A, Crystal Structure Of Designed Pentatricopeptide Repeat Protein Dppr- U8a2 In Complex With Its Target Rna U8a2 Length = 460 Score = 56.2 bits (134), Expect = 7e-06 Identities = 29/90 (32%), Positives = 53/90 (58%) Frame = +2 Query: 5 TYSMMIAKFLEKGEVEISISILDELVGKKFKAGVDLYSGIVRGLHKCGRVDESRKWLNLM 184 TYS +I + G+++ ++ + +E+V K K V YS ++ GL K G++DE+ K M Sbjct: 193 TYSTLIDGLCKAGKLDEALKLFEEMVEKGIKPNVVTYSTLIDGLCKAGKLDEALKLFEEM 252 Query: 185 IEKGILVSYEGWESLYDSVTMEGELWKAIE 274 +EKGI + + +L D + G+L +A++ Sbjct: 253 VEKGIKPNVVTYNTLIDGLCKAGKLDEALK 282