BLASTX nr result
ID: Ophiopogon26_contig00035445
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00035445 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017698273.1| PREDICTED: uncharacterized protein LOC108511... 53 1e-06 >ref|XP_017698273.1| PREDICTED: uncharacterized protein LOC108511316 [Phoenix dactylifera] Length = 73 Score = 52.8 bits (125), Expect = 1e-06 Identities = 30/47 (63%), Positives = 31/47 (65%), Gaps = 5/47 (10%) Frame = +3 Query: 78 MGGARKSSFFCC---FSG-SRYMD-DEVDWSPRYHRKIRPSDYDGGR 203 MGG SFFC FSG SRY D D+VDW P Y RKIRPSD D GR Sbjct: 1 MGGKMSRSFFCFVFKFSGRSRYRDVDDVDWEPTYTRKIRPSDEDRGR 47