BLASTX nr result
ID: Ophiopogon26_contig00035444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00035444 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017698273.1| PREDICTED: uncharacterized protein LOC108511... 55 1e-07 >ref|XP_017698273.1| PREDICTED: uncharacterized protein LOC108511316 [Phoenix dactylifera] Length = 73 Score = 55.1 bits (131), Expect = 1e-07 Identities = 31/46 (67%), Positives = 31/46 (67%), Gaps = 5/46 (10%) Frame = +3 Query: 78 MGGARKSSFFCC---FSG-SRYMD-DDVDWSPRYHRKIRPSDYDRG 200 MGG SFFC FSG SRY D DDVDW P Y RKIRPSD DRG Sbjct: 1 MGGKMSRSFFCFVFKFSGRSRYRDVDDVDWEPTYTRKIRPSDEDRG 46