BLASTX nr result
ID: Ophiopogon26_contig00035154
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00035154 (616 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF25532.1| conserved hypothetical protein [Ricinus communis]... 74 7e-14 dbj|GAV61910.1| hypothetical protein CFOL_v3_05435, partial [Cep... 59 2e-08 >gb|EEF25532.1| conserved hypothetical protein [Ricinus communis] gb|EEF26949.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 73.9 bits (180), Expect = 7e-14 Identities = 36/50 (72%), Positives = 43/50 (86%), Gaps = 2/50 (4%) Frame = -3 Query: 272 RAPALLAFFTGARQMYHSSRS*--GKESSVCFHYYGNELHMLVSNCSGIY 129 ++ ALLAFFTGAR+MYHSSRS GKESSVC++ YG+E HMLV NCSGI+ Sbjct: 39 KSSALLAFFTGARRMYHSSRSPRSGKESSVCYNLYGDESHMLVENCSGIH 88 >dbj|GAV61910.1| hypothetical protein CFOL_v3_05435, partial [Cephalotus follicularis] Length = 41 Score = 58.5 bits (140), Expect = 2e-08 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -3 Query: 272 RAPALLAFFTGARQMYHSSRS*GKESSVCFHYYGNELHMLVSNCSGIY 129 ++ ALLAFFTGAR+MYHSSR +YGNE HMLV NCSGI+ Sbjct: 2 KSSALLAFFTGARRMYHSSRR--------IFFYGNESHMLVENCSGIH 41