BLASTX nr result
ID: Ophiopogon26_contig00035111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00035111 (547 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241775.1| ribose-phosphate pyrophosphokinase 1-like [A... 58 1e-06 gb|ONK58979.1| uncharacterized protein A4U43_C08F1720 [Asparagus... 58 1e-06 >ref|XP_020241775.1| ribose-phosphate pyrophosphokinase 1-like [Asparagus officinalis] Length = 398 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 101 CKLIEPLGYSNGAPLRIPVISDQTLPGFLTATN 3 CKLIEPLG+SNGA RIP+++DQTLPGFLT T+ Sbjct: 38 CKLIEPLGFSNGAVPRIPIVNDQTLPGFLTGTS 70 >gb|ONK58979.1| uncharacterized protein A4U43_C08F1720 [Asparagus officinalis] Length = 444 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 101 CKLIEPLGYSNGAPLRIPVISDQTLPGFLTATN 3 CKLIEPLG+SNGA RIP+++DQTLPGFLT T+ Sbjct: 84 CKLIEPLGFSNGAVPRIPIVNDQTLPGFLTGTS 116