BLASTX nr result
ID: Ophiopogon26_contig00035056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00035056 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020160306.1| uncharacterized protein LOC109745596 [Aegilo... 55 7e-06 >ref|XP_020160306.1| uncharacterized protein LOC109745596 [Aegilops tauschii subsp. tauschii] Length = 649 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/59 (42%), Positives = 41/59 (69%) Frame = +1 Query: 43 EAEERRLHTMEKKLEIRQKDHELKERLEEDRIMTLDITSLNETQRMYFMFRQKEIMQKR 219 E +ER L KKLE+R+++ EL+ RLE+ RIM +DI+++ Q+ ++M Q EI+ +R Sbjct: 586 EVKERELEFKRKKLEVRERELELQRRLEDGRIMDMDISAMTGRQQQFYMSLQSEIIARR 644