BLASTX nr result
ID: Ophiopogon26_contig00034970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034970 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK78721.1| uncharacterized protein A4U43_C02F21740 [Asparagu... 58 1e-06 >gb|ONK78721.1| uncharacterized protein A4U43_C02F21740 [Asparagus officinalis] Length = 422 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = -2 Query: 509 TSVQWVNLHTVADSQQYLEFTRHAIDVIEKLKSPLPSTAEIDDDFDELAP 360 T+VQ V L++ D+Q LEF R IDV+ LK+ LP+T E DD+FDEL P Sbjct: 213 TAVQLVKLYSTTDTQNSLEFPRDEIDVVSVLKASLPNTVEADDEFDELGP 262