BLASTX nr result
ID: Ophiopogon26_contig00034908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034908 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248341.1| probable sugar phosphate/phosphate transloca... 68 1e-10 >ref|XP_020248341.1| probable sugar phosphate/phosphate translocator At1g06470 isoform X1 [Asparagus officinalis] ref|XP_020248349.1| probable sugar phosphate/phosphate translocator At1g06470 isoform X1 [Asparagus officinalis] Length = 479 Score = 68.2 bits (165), Expect = 1e-10 Identities = 50/114 (43%), Positives = 62/114 (54%), Gaps = 9/114 (7%) Frame = +1 Query: 109 MEPQNSEETGEDPXXXXXXXXXXXYPNPKP-NLRKEPSFNRWCGDAPLLGHSPTASFDGI 285 M+PQN ++ E+ +P+P N RKEPSF+RWCGD + + FDGI Sbjct: 1 MQPQNPDDDLEEESWSPSIT------DPRPTNHRKEPSFSRWCGDYD--DDASSLCFDGI 52 Query: 286 IVEDS--------VDFELPLLHNDAEIEAQASYFRQRSTVADHHHHLKDRRSTA 423 + DS +FELP L A ASYFRQRS+VAD LKDRRSTA Sbjct: 53 SIADSSSSSAADAEEFELPFL----PALADASYFRQRSSVAD----LKDRRSTA 98