BLASTX nr result
ID: Ophiopogon26_contig00034866
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034866 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260034.1| filament-like plant protein 3 [Asparagus off... 82 9e-16 >ref|XP_020260034.1| filament-like plant protein 3 [Asparagus officinalis] gb|ONK70990.1| uncharacterized protein A4U43_C04F3590 [Asparagus officinalis] Length = 892 Score = 82.4 bits (202), Expect = 9e-16 Identities = 44/67 (65%), Positives = 48/67 (71%) Frame = -3 Query: 368 LSRQLKLLTDFDLMLEAEEPEHDDKEIFGNSSLPNGQERGLRQSSTPSHLPDFGKCLSPS 189 LS+QLK L DFDLMLE EEP DKE SLPN +ERGL QSS +P+ KCLSPS Sbjct: 825 LSQQLKFLRDFDLMLETEEPNLGDKEDLIIPSLPNDEERGLIQSSAYLPVPEHEKCLSPS 884 Query: 188 RSYIHIQ 168 RSYIHIQ Sbjct: 885 RSYIHIQ 891