BLASTX nr result
ID: Ophiopogon26_contig00034814
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034814 (616 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71979.1| uncharacterized protein A4U43_C04F14400 [Asparagu... 80 4e-14 >gb|ONK71979.1| uncharacterized protein A4U43_C04F14400 [Asparagus officinalis] Length = 334 Score = 79.7 bits (195), Expect = 4e-14 Identities = 40/65 (61%), Positives = 45/65 (69%) Frame = -2 Query: 399 QKKGNGQEKQVECKKPQSNLNPKDMETVMIVKSFTFKATPLPSFYQKRSATPKSDSIEHA 220 QKKGNGQ KQ++ KK Q NPK M+ KS FKATPLPSFY KR TPK DSIE Sbjct: 121 QKKGNGQVKQIDSKKSQPVSNPKGMDIGNPEKSLPFKATPLPSFYHKRLVTPKLDSIERV 180 Query: 219 EQDID 205 EQD++ Sbjct: 181 EQDME 185