BLASTX nr result
ID: Ophiopogon26_contig00034727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034727 (693 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKH56553.1| hypothetical protein CRG98_050304, partial [Punic... 54 3e-06 ref|XP_020235087.1| phosphatase IMPL1, chloroplastic-like [Cajan... 57 3e-06 ref|XP_021675916.1| phosphatase IMPL1, chloroplastic-like [Hevea... 53 9e-06 >gb|PKH56553.1| hypothetical protein CRG98_050304, partial [Punica granatum] Length = 88 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +3 Query: 3 LGIVEAYWEYRLKPWDMAAGVLII 74 LGIVEAYWEYRLKPWDMAAGVLI+ Sbjct: 17 LGIVEAYWEYRLKPWDMAAGVLIV 40 >ref|XP_020235087.1| phosphatase IMPL1, chloroplastic-like [Cajanus cajan] Length = 199 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/59 (54%), Positives = 35/59 (59%), Gaps = 9/59 (15%) Frame = +3 Query: 3 LGIVEAYWEYRLKPWDMAAGV---------LIINLSLIDTTLXXXXXXXXXL*PDRDLF 152 LGIVEAYWEYRLKPWDMAAGV LII L+++D TL PD D F Sbjct: 94 LGIVEAYWEYRLKPWDMAAGVLVWFMSFTSLIIILTIVDLTLLPDEQILNGNQPDMDDF 152 >ref|XP_021675916.1| phosphatase IMPL1, chloroplastic-like [Hevea brasiliensis] Length = 93 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +3 Query: 3 LGIVEAYWEYRLKPWDMAAGVLII 74 LGIVEAYWEYRLKPWDMAAGVL++ Sbjct: 6 LGIVEAYWEYRLKPWDMAAGVLMV 29