BLASTX nr result
ID: Ophiopogon26_contig00034662
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034662 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK76026.1| uncharacterized protein A4U43_C03F23060 [Asparagu... 65 5e-13 >gb|ONK76026.1| uncharacterized protein A4U43_C03F23060 [Asparagus officinalis] Length = 1122 Score = 65.1 bits (157), Expect(2) = 5e-13 Identities = 32/63 (50%), Positives = 44/63 (69%) Frame = -1 Query: 237 HHRNLTFGRAHQNDEEQKYLAEENQ*CKSLPGRKRIKTLSLYFYPGRNHEKMAAGWFEQA 58 H +L+FGRA +++EEQ+ LA+E Q G KRI T +L FYPGR +E++AA W +QA Sbjct: 684 HPTDLSFGRATESEEEQRELAQEIQAYMKHNGNKRIVTFTLNFYPGRKYEQIAAEWIKQA 743 Query: 57 ATN 49 A N Sbjct: 744 AKN 746 Score = 36.6 bits (83), Expect(2) = 5e-13 Identities = 17/26 (65%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -2 Query: 302 KYVVRTGVLSSKWKDLWK-RWFLTTE 228 K VRTG LS+KWKDLWK R+F T+ Sbjct: 662 KAAVRTGALSTKWKDLWKERYFHPTD 687