BLASTX nr result
ID: Ophiopogon26_contig00034504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034504 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009393173.2| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 ref|XP_010941590.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_020256176.1| pentatricopeptide repeat-containing protein ... 56 7e-06 >ref|XP_009393173.2| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial [Musa acuminata subsp. malaccensis] Length = 415 Score = 63.2 bits (152), Expect = 2e-08 Identities = 37/83 (44%), Positives = 47/83 (56%), Gaps = 12/83 (14%) Frame = -1 Query: 217 CKPSSASLFEAEPLQCRLHSDS-ALQLFDKMQRRLCNNSTTI-----------GRVSKGM 74 C+P++ + C S AL+L D+MQ+ C+ T GRVS+GM Sbjct: 260 CRPNATTYSTIMHYLCEHDKVSEALELCDRMQKNGCHPDTITFNILISGLCKQGRVSEGM 319 Query: 73 ELLKAMQLKGCYPNSGTY*ALLY 5 E LK M+LKGCYPNSGTY ALLY Sbjct: 320 EFLKTMKLKGCYPNSGTYQALLY 342 >ref|XP_010941590.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Elaeis guineensis] ref|XP_010941591.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Elaeis guineensis] Length = 383 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/83 (39%), Positives = 47/83 (56%), Gaps = 12/83 (14%) Frame = -1 Query: 217 CKPSSASLFEAEPLQCRLHSDS-ALQLFDKMQRRLCNNSTTI-----------GRVSKGM 74 C+P++ + C+ S A +L ++M++ C+ T G+V+KGM Sbjct: 228 CRPNATTYSTLMHALCKDDKPSEAFELCERMEKEGCHPDTITFNILISGLCKQGQVAKGM 287 Query: 73 ELLKAMQLKGCYPNSGTY*ALLY 5 ELLK M+LKGCYPNSGT ALLY Sbjct: 288 ELLKTMKLKGCYPNSGTNQALLY 310 >ref|XP_020256176.1| pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Asparagus officinalis] ref|XP_020256177.1| pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Asparagus officinalis] ref|XP_020256178.1| pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Asparagus officinalis] gb|ONK74402.1| uncharacterized protein A4U43_C03F5850 [Asparagus officinalis] Length = 404 Score = 55.8 bits (133), Expect = 7e-06 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 11/62 (17%) Frame = -1 Query: 157 DSALQLFDKMQRRLCNNSTTI-----------GRVSKGMELLKAMQLKGCYPNSGTY*AL 11 D A +L D+M+R C T + RV +G+ELLK M+LKGCYPNSG+Y AL Sbjct: 249 DEAFELCDRMEREKCYPDTVMFNVLISGLCKQRRVREGIELLKGMKLKGCYPNSGSYQAL 308 Query: 10 LY 5 +Y Sbjct: 309 VY 310