BLASTX nr result
ID: Ophiopogon26_contig00034343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034343 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHH02398.1| gamma-glutamyl phosphate reductase, partial [Aegi... 63 6e-10 gb|PKI46608.1| hypothetical protein CRG98_032950, partial [Punic... 63 3e-09 gb|AHN92203.1| delta-1-pyrroline-5-carbosylate synthetase, parti... 63 4e-09 emb|CAG29643.1| delta 1-pyrroline-5-carboxylate synthetase, part... 63 5e-09 gb|ABT17466.1| delta 1-pyrroline-5-carboxylate synthetase, parti... 63 6e-09 gb|KDO48133.1| hypothetical protein CISIN_1g004665mg [Citrus sin... 63 6e-09 gb|PIA54604.1| hypothetical protein AQUCO_00900873v1 [Aquilegia ... 63 6e-09 ref|XP_021821672.1| delta-1-pyrroline-5-carboxylate synthase-lik... 63 6e-09 gb|PIA54603.1| hypothetical protein AQUCO_00900873v1 [Aquilegia ... 63 6e-09 ref|XP_010691531.1| PREDICTED: delta-1-pyrroline-5-carboxylate s... 63 6e-09 ref|XP_020252470.1| delta-1-pyrroline-5-carboxylate synthase-lik... 63 6e-09 gb|KDO48131.1| hypothetical protein CISIN_1g004665mg [Citrus sin... 63 6e-09 gb|ESR42429.1| hypothetical protein CICLE_v10011176mg [Citrus cl... 63 6e-09 dbj|GAY49757.1| hypothetical protein CUMW_121530 [Citrus unshiu] 63 6e-09 dbj|GAY49758.1| hypothetical protein CUMW_121530 [Citrus unshiu]... 63 6e-09 gb|KDO48132.1| hypothetical protein CISIN_1g004665mg [Citrus sin... 63 6e-09 gb|ESR42428.1| hypothetical protein CICLE_v10011176mg [Citrus cl... 63 6e-09 ref|XP_024189906.1| delta-1-pyrroline-5-carboxylate synthase-lik... 63 6e-09 ref|XP_021769059.1| delta-1-pyrroline-5-carboxylate synthase-lik... 63 6e-09 gb|ERN08053.1| hypothetical protein AMTR_s00012p00263260 [Ambore... 63 6e-09 >gb|AHH02398.1| gamma-glutamyl phosphate reductase, partial [Aegiceras corniculatum] Length = 142 Score = 63.2 bits (152), Expect = 6e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 75 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 107 >gb|PKI46608.1| hypothetical protein CRG98_032950, partial [Punica granatum] Length = 215 Score = 62.8 bits (151), Expect = 3e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 260 VDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 +DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 1 LDDVIDLIIPRGSNKLVSQIKESTKIPVLGHA 32 >gb|AHN92203.1| delta-1-pyrroline-5-carbosylate synthetase, partial [Camellia sinensis] Length = 312 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 241 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 273 >emb|CAG29643.1| delta 1-pyrroline-5-carboxylate synthetase, partial [Glycine max] Length = 276 Score = 62.8 bits (151), Expect = 5e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL++PRGSNKLVSQIKESTKIPVLGHA Sbjct: 72 KLDDVIDLVVPRGSNKLVSQIKESTKIPVLGHA 104 >gb|ABT17466.1| delta 1-pyrroline-5-carboxylate synthetase, partial [Opuntia streptacantha] Length = 467 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 392 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 424 >gb|KDO48133.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis] Length = 560 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 322 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 354 >gb|PIA54604.1| hypothetical protein AQUCO_00900873v1 [Aquilegia coerulea] Length = 614 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 376 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 408 >ref|XP_021821672.1| delta-1-pyrroline-5-carboxylate synthase-like [Prunus avium] Length = 615 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 376 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 408 >gb|PIA54603.1| hypothetical protein AQUCO_00900873v1 [Aquilegia coerulea] Length = 616 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 476 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 508 >ref|XP_010691531.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X3 [Beta vulgaris subsp. vulgaris] Length = 616 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 376 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 408 >ref|XP_020252470.1| delta-1-pyrroline-5-carboxylate synthase-like isoform X2 [Asparagus officinalis] Length = 622 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 479 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 511 >gb|KDO48131.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis] Length = 643 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 477 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 509 >gb|ESR42429.1| hypothetical protein CICLE_v10011176mg [Citrus clementina] Length = 643 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 477 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 509 >dbj|GAY49757.1| hypothetical protein CUMW_121530 [Citrus unshiu] Length = 658 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 464 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 496 >dbj|GAY49758.1| hypothetical protein CUMW_121530 [Citrus unshiu] dbj|GAY49759.1| hypothetical protein CUMW_121530 [Citrus unshiu] Length = 661 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 467 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 499 >gb|KDO48132.1| hypothetical protein CISIN_1g004665mg [Citrus sinensis] Length = 676 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 438 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 470 >gb|ESR42428.1| hypothetical protein CICLE_v10011176mg [Citrus clementina] Length = 676 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 438 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 470 >ref|XP_024189906.1| delta-1-pyrroline-5-carboxylate synthase-like isoform X3 [Rosa chinensis] Length = 692 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 454 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 486 >ref|XP_021769059.1| delta-1-pyrroline-5-carboxylate synthase-like isoform X1 [Chenopodium quinoa] Length = 696 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 456 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 488 >gb|ERN08053.1| hypothetical protein AMTR_s00012p00263260 [Amborella trichopoda] Length = 698 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 QVDDVIDLMIPRGSNKLVSQIKESTKIPVLGHA 165 ++DDVIDL+IPRGSNKLVSQIKESTKIPVLGHA Sbjct: 460 KLDDVIDLVIPRGSNKLVSQIKESTKIPVLGHA 492