BLASTX nr result
ID: Ophiopogon26_contig00034230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00034230 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA57505.1| hypothetical protein AXF42_Ash020749 [Apostasia s... 58 2e-07 gb|PKU61515.1| hypothetical protein MA16_Dca028763 [Dendrobium c... 59 3e-07 gb|PKU74568.1| hypothetical protein MA16_Dca003771 [Dendrobium c... 57 5e-07 gb|PKU65889.1| hypothetical protein MA16_Dca009218 [Dendrobium c... 56 9e-07 gb|PKA46655.1| hypothetical protein AXF42_Ash021271 [Apostasia s... 54 5e-06 >gb|PKA57505.1| hypothetical protein AXF42_Ash020749 [Apostasia shenzhenica] Length = 187 Score = 57.8 bits (138), Expect = 2e-07 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 9/72 (12%) Frame = -2 Query: 194 AECRKSFKTFHVGDYVMIQIS---------LNLHTHRNGPFKILNKLDCNTYVLDLLKNY 42 A+ K + F GDYVMI++ L GPFKIL KL+ NTYV+DL N+ Sbjct: 60 ADAHKRLQEFSKGDYVMIRVRPERFPSGVIKKLQARGAGPFKILKKLESNTYVVDLPSNF 119 Query: 41 DISCVFNINVLV 6 IS +FNI+ LV Sbjct: 120 GISTIFNISDLV 131 >gb|PKU61515.1| hypothetical protein MA16_Dca028763 [Dendrobium catenatum] Length = 311 Score = 58.5 bits (140), Expect = 3e-07 Identities = 31/72 (43%), Positives = 45/72 (62%), Gaps = 9/72 (12%) Frame = -2 Query: 194 AECRKSFKTFHVGDYVMIQIS---------LNLHTHRNGPFKILNKLDCNTYVLDLLKNY 42 A+ ++ FKTF VGD+VM++I LH GPFKIL K++ N YV+DL +++ Sbjct: 200 ADLKRRFKTFKVGDFVMVRIRPERFPQGTVKKLHAKSAGPFKILRKVNDNAYVVDLPEDF 259 Query: 41 DISCVFNINVLV 6 +I+ FNI LV Sbjct: 260 NINPTFNIEDLV 271 >gb|PKU74568.1| hypothetical protein MA16_Dca003771 [Dendrobium catenatum] Length = 252 Score = 57.4 bits (137), Expect = 5e-07 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 9/72 (12%) Frame = -2 Query: 194 AECRKSFKTFHVGDYVMIQIS---------LNLHTHRNGPFKILNKLDCNTYVLDLLKNY 42 A+ ++ FKTF VGD+VM++I LH GPFKIL K++ N Y++DL ++ Sbjct: 40 ADLKRRFKTFEVGDFVMVRIRPERFPPGTVKKLHAKSAGPFKILKKINDNAYIVDLPADF 99 Query: 41 DISCVFNINVLV 6 +I+ FNI LV Sbjct: 100 NINPSFNIEDLV 111 >gb|PKU65889.1| hypothetical protein MA16_Dca009218 [Dendrobium catenatum] Length = 208 Score = 56.2 bits (134), Expect = 9e-07 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 9/69 (13%) Frame = -2 Query: 185 RKSFKTFHVGDYVMIQIS---------LNLHTHRNGPFKILNKLDCNTYVLDLLKNYDIS 33 +K FK F V D+VM++I LH PFKI++K++ N YVLDLLK ++I+ Sbjct: 39 KKRFKEFEVEDFVMVRIRPRRFPQGSVKKLHAKSARPFKIISKINSNNYVLDLLKGFNIN 98 Query: 32 CVFNINVLV 6 FNI LV Sbjct: 99 HTFNIEYLV 107 >gb|PKA46655.1| hypothetical protein AXF42_Ash021271 [Apostasia shenzhenica] Length = 186 Score = 53.9 bits (128), Expect = 5e-06 Identities = 31/72 (43%), Positives = 39/72 (54%), Gaps = 9/72 (12%) Frame = -2 Query: 194 AECRKSFKTFHVGDYVMIQISLN---------LHTHRNGPFKILNKLDCNTYVLDLLKNY 42 A+ K + F GDYVMI++ L L GPFKIL KL N YV+DL ++ Sbjct: 60 ADAHKRLQEFSEGDYVMIRVRLERFPSGVVKKLQARGAGPFKILKKLGSNAYVVDLPSDF 119 Query: 41 DISCVFNINVLV 6 IS FNI+ LV Sbjct: 120 GISTTFNISDLV 131